Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VC06

Protein Details
Accession A0A409VC06    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
113-139SLLGASRPSRKYRNKKKEDDKKDGGVLHydrophilic
NLS Segment(s)
PositionSequence
120-129PSRKYRNKKK
Subcellular Location(s) cyto 14.5, cyto_nucl 8, extr 7, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNPNFNLVFIALLASASAPALINARPIESTHFGRDEAALTGQLEASADNVLPLPIDLDIDGLGLDGITGTVEDAVKGIKDGVLAIVPAGLLGLDLKKGVVGGVSKTVDSLLDSLLGASRPSRKYRNKKKEDDKKDGGVLGGLGLDGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.05
5 0.04
6 0.05
7 0.06
8 0.07
9 0.1
10 0.11
11 0.12
12 0.12
13 0.13
14 0.18
15 0.21
16 0.24
17 0.24
18 0.25
19 0.25
20 0.25
21 0.25
22 0.2
23 0.17
24 0.14
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.07
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.02
77 0.02
78 0.02
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.03
86 0.05
87 0.05
88 0.06
89 0.11
90 0.11
91 0.11
92 0.12
93 0.12
94 0.11
95 0.1
96 0.1
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.09
105 0.16
106 0.19
107 0.26
108 0.36
109 0.46
110 0.57
111 0.68
112 0.77
113 0.81
114 0.87
115 0.93
116 0.94
117 0.93
118 0.92
119 0.88
120 0.82
121 0.75
122 0.66
123 0.55
124 0.44
125 0.34
126 0.24
127 0.17
128 0.1