Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WL96

Protein Details
Accession A0A409WL96    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-88QLRINEWQRRKRIKLQKEIEHydrophilic
NLS Segment(s)
PositionSequence
29-82KSRARARAQQKRKDETPQEAETRKARHREAASRYRKANRAQLRINEWQRRKRIK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTESGILKTPQKKLEARKQYYIRNHEQEKSRARARAQQKRKDETPQEAETRKARHREAASRYRKANRAQLRINEWQRRKRIKLQKEIEADEEEFQRLWALED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.68
4 0.71
5 0.73
6 0.75
7 0.78
8 0.76
9 0.74
10 0.72
11 0.7
12 0.66
13 0.67
14 0.66
15 0.63
16 0.62
17 0.58
18 0.54
19 0.51
20 0.54
21 0.57
22 0.6
23 0.63
24 0.66
25 0.69
26 0.71
27 0.72
28 0.72
29 0.67
30 0.63
31 0.59
32 0.54
33 0.51
34 0.45
35 0.45
36 0.4
37 0.4
38 0.37
39 0.35
40 0.32
41 0.34
42 0.37
43 0.42
44 0.46
45 0.52
46 0.56
47 0.56
48 0.61
49 0.6
50 0.61
51 0.58
52 0.6
53 0.58
54 0.58
55 0.59
56 0.59
57 0.6
58 0.63
59 0.68
60 0.68
61 0.67
62 0.68
63 0.71
64 0.75
65 0.75
66 0.76
67 0.78
68 0.78
69 0.81
70 0.8
71 0.79
72 0.77
73 0.73
74 0.66
75 0.6
76 0.51
77 0.43
78 0.37
79 0.29
80 0.22
81 0.19
82 0.17