Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VU76

Protein Details
Accession A0A409VU76    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
144-170STTSQRALPRRNRPIRRAIERRRSVLQHydrophilic
NLS Segment(s)
PositionSequence
153-165RRNRPIRRAIERR
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MPSKPRSSSGTPRSTRSNSVSSASSSSSRSTKYVPLHKRPGSSRSSVASSSRPSSPNSVRSSTPENLRGVYSLEALLALRPLADEGMKQRMKDTCPDIVMNRRMRKSLQYIALHPHLRTQPQDTPLDSHAEEEDVASEPTTTASTTSQRALPRRNRPIRRAIERRRSVLQETWKGVRVPPIQPLPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.58
4 0.53
5 0.45
6 0.45
7 0.42
8 0.36
9 0.34
10 0.3
11 0.26
12 0.23
13 0.24
14 0.24
15 0.24
16 0.24
17 0.25
18 0.29
19 0.35
20 0.44
21 0.5
22 0.57
23 0.65
24 0.67
25 0.7
26 0.68
27 0.66
28 0.61
29 0.56
30 0.5
31 0.43
32 0.42
33 0.37
34 0.35
35 0.33
36 0.31
37 0.3
38 0.31
39 0.29
40 0.28
41 0.33
42 0.36
43 0.39
44 0.4
45 0.4
46 0.37
47 0.39
48 0.44
49 0.4
50 0.39
51 0.36
52 0.32
53 0.3
54 0.3
55 0.26
56 0.21
57 0.18
58 0.14
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.05
65 0.04
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.06
73 0.15
74 0.17
75 0.17
76 0.19
77 0.21
78 0.23
79 0.26
80 0.27
81 0.21
82 0.21
83 0.22
84 0.22
85 0.26
86 0.33
87 0.36
88 0.38
89 0.37
90 0.37
91 0.37
92 0.39
93 0.38
94 0.37
95 0.38
96 0.35
97 0.35
98 0.39
99 0.43
100 0.4
101 0.34
102 0.33
103 0.28
104 0.28
105 0.28
106 0.29
107 0.28
108 0.31
109 0.33
110 0.29
111 0.3
112 0.29
113 0.31
114 0.25
115 0.21
116 0.17
117 0.15
118 0.14
119 0.11
120 0.1
121 0.08
122 0.08
123 0.07
124 0.07
125 0.06
126 0.07
127 0.08
128 0.07
129 0.07
130 0.09
131 0.12
132 0.14
133 0.16
134 0.19
135 0.25
136 0.31
137 0.4
138 0.47
139 0.55
140 0.64
141 0.73
142 0.78
143 0.79
144 0.83
145 0.83
146 0.84
147 0.84
148 0.84
149 0.85
150 0.83
151 0.82
152 0.78
153 0.73
154 0.67
155 0.63
156 0.63
157 0.6
158 0.58
159 0.57
160 0.55
161 0.51
162 0.47
163 0.49
164 0.45
165 0.39
166 0.43
167 0.45