Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VGD1

Protein Details
Accession A0A409VGD1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
41-65TSLYRPTKSVSRRRRSPRRALHAFDHydrophilic
NLS Segment(s)
PositionSequence
52-58RRRRSPR
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MPQNHSKRPILSPSPLLSSPFPPFERLGSPIHLHSEPIASTSLYRPTKSVSRRRRSPRRALHAFDDLPWRSTLDESPQFINPSDIADLSLISNSGPIRTRKSSLRSTPLSSPPPTSPITPCDTSYLSRFLTPPPRIIPSRVLFKNLMPVSCDSDSSLPCITTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.44
4 0.37
5 0.35
6 0.34
7 0.33
8 0.32
9 0.29
10 0.29
11 0.29
12 0.3
13 0.28
14 0.27
15 0.26
16 0.27
17 0.25
18 0.28
19 0.26
20 0.23
21 0.21
22 0.2
23 0.16
24 0.15
25 0.14
26 0.1
27 0.11
28 0.13
29 0.21
30 0.21
31 0.21
32 0.21
33 0.24
34 0.31
35 0.39
36 0.48
37 0.5
38 0.58
39 0.67
40 0.77
41 0.85
42 0.86
43 0.88
44 0.88
45 0.87
46 0.84
47 0.78
48 0.72
49 0.67
50 0.58
51 0.49
52 0.45
53 0.36
54 0.3
55 0.26
56 0.22
57 0.16
58 0.16
59 0.15
60 0.15
61 0.18
62 0.18
63 0.19
64 0.2
65 0.2
66 0.2
67 0.2
68 0.13
69 0.11
70 0.1
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.04
79 0.05
80 0.05
81 0.07
82 0.1
83 0.12
84 0.17
85 0.2
86 0.23
87 0.27
88 0.33
89 0.4
90 0.43
91 0.49
92 0.47
93 0.48
94 0.51
95 0.52
96 0.51
97 0.44
98 0.42
99 0.36
100 0.36
101 0.33
102 0.3
103 0.26
104 0.24
105 0.28
106 0.27
107 0.26
108 0.26
109 0.27
110 0.26
111 0.27
112 0.27
113 0.23
114 0.22
115 0.22
116 0.24
117 0.32
118 0.32
119 0.34
120 0.34
121 0.39
122 0.39
123 0.42
124 0.45
125 0.4
126 0.48
127 0.45
128 0.45
129 0.41
130 0.4
131 0.46
132 0.41
133 0.36
134 0.29
135 0.3
136 0.32
137 0.32
138 0.32
139 0.24
140 0.26
141 0.25
142 0.26
143 0.26