Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WC94

Protein Details
Accession A0A409WC94    Localization Confidence High Confidence Score 21.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTTNLDEKRRKRREYYLRNLEEHydrophilic
63-89IQLRIHEWQRRVRKKRQKEWEADEAEYHydrophilic
NLS Segment(s)
PositionSequence
9-13RRKRR
25-62QRAREYARRRREEESPQEAELRRRRHREAASRYRDQNR
65-79LRIHEWQRRVRKKRQ
Subcellular Location(s) nucl 21, cyto 3, mito 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MTTNLDEKRRKRREYYLRNLEEERQRAREYARRRREEESPQEAELRRRRHREAASRYRDQNRIQLRIHEWQRRVRKKRQKEWEADEAEYQALMAAQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.85
4 0.8
5 0.78
6 0.73
7 0.69
8 0.65
9 0.6
10 0.53
11 0.46
12 0.42
13 0.39
14 0.41
15 0.42
16 0.45
17 0.5
18 0.56
19 0.58
20 0.61
21 0.63
22 0.65
23 0.67
24 0.66
25 0.62
26 0.55
27 0.49
28 0.49
29 0.46
30 0.47
31 0.44
32 0.43
33 0.43
34 0.45
35 0.47
36 0.51
37 0.57
38 0.6
39 0.63
40 0.66
41 0.66
42 0.66
43 0.69
44 0.67
45 0.66
46 0.58
47 0.56
48 0.51
49 0.5
50 0.46
51 0.45
52 0.43
53 0.47
54 0.53
55 0.53
56 0.5
57 0.54
58 0.63
59 0.69
60 0.73
61 0.75
62 0.78
63 0.82
64 0.88
65 0.9
66 0.89
67 0.88
68 0.88
69 0.87
70 0.8
71 0.71
72 0.62
73 0.52
74 0.42
75 0.32
76 0.24
77 0.14