Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YGJ2

Protein Details
Accession A0A409YGJ2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
315-341SYFNHSCIPNIKKRRDKQKLIFYTLRDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 7, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50280  SET  
CDD cd20071  SET_SMYD  
Amino Acid Sequences MGVDTAFYSIEPTPYGGRGAFARHQIAKGQVILETTGPYAGVIFRKFRREVCGACFAYAFESGKNKWSVRLVEEEAVGGAGLWFCSSECRDDWISERVCNGDITWVLDLYRALERLIDQMSKAGRKKVKAANSNPFHYLENVSADQITQSFLEATWKQAEELSRYDAKHEWTEELNEFELDTVRYILDGLVRKVSEHLSSTVKSDRSPHGTGTWEDFAQLQDNELPFLISKPYLLSSHIKTYLFIRHLCPLLKRSKGSCSESQTSISKISEYLETPTFVRMLLSRDPGNVFGIWDMAPEGEESEMLGWGAFTFASYFNHSCIPNIKKRRDKQKLIFYTLRDIQQGEEMCISYTDETAPLKERRALLNRNWFFQCCCAKCHDEQNEVAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.15
4 0.16
5 0.17
6 0.22
7 0.25
8 0.28
9 0.33
10 0.34
11 0.35
12 0.37
13 0.4
14 0.37
15 0.34
16 0.29
17 0.25
18 0.23
19 0.22
20 0.19
21 0.16
22 0.13
23 0.11
24 0.11
25 0.09
26 0.08
27 0.1
28 0.14
29 0.16
30 0.22
31 0.26
32 0.34
33 0.37
34 0.39
35 0.43
36 0.45
37 0.46
38 0.46
39 0.51
40 0.45
41 0.43
42 0.41
43 0.34
44 0.3
45 0.29
46 0.23
47 0.16
48 0.2
49 0.2
50 0.25
51 0.3
52 0.29
53 0.29
54 0.34
55 0.35
56 0.33
57 0.39
58 0.36
59 0.33
60 0.33
61 0.29
62 0.23
63 0.2
64 0.16
65 0.09
66 0.06
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.07
73 0.09
74 0.11
75 0.12
76 0.17
77 0.18
78 0.2
79 0.23
80 0.28
81 0.29
82 0.27
83 0.27
84 0.24
85 0.23
86 0.22
87 0.19
88 0.14
89 0.13
90 0.14
91 0.13
92 0.12
93 0.11
94 0.12
95 0.11
96 0.1
97 0.12
98 0.1
99 0.09
100 0.1
101 0.1
102 0.12
103 0.14
104 0.13
105 0.11
106 0.14
107 0.17
108 0.23
109 0.25
110 0.3
111 0.32
112 0.34
113 0.42
114 0.46
115 0.52
116 0.55
117 0.61
118 0.64
119 0.65
120 0.65
121 0.59
122 0.54
123 0.45
124 0.37
125 0.31
126 0.21
127 0.2
128 0.17
129 0.15
130 0.13
131 0.13
132 0.11
133 0.1
134 0.09
135 0.06
136 0.05
137 0.05
138 0.05
139 0.1
140 0.1
141 0.12
142 0.14
143 0.14
144 0.14
145 0.16
146 0.17
147 0.15
148 0.17
149 0.19
150 0.2
151 0.2
152 0.22
153 0.22
154 0.23
155 0.23
156 0.22
157 0.2
158 0.17
159 0.2
160 0.18
161 0.18
162 0.15
163 0.13
164 0.12
165 0.1
166 0.1
167 0.07
168 0.07
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.08
175 0.09
176 0.1
177 0.11
178 0.12
179 0.12
180 0.13
181 0.14
182 0.11
183 0.11
184 0.13
185 0.13
186 0.14
187 0.16
188 0.19
189 0.18
190 0.18
191 0.2
192 0.22
193 0.26
194 0.26
195 0.25
196 0.23
197 0.25
198 0.25
199 0.25
200 0.23
201 0.17
202 0.16
203 0.15
204 0.13
205 0.13
206 0.12
207 0.09
208 0.1
209 0.1
210 0.1
211 0.1
212 0.09
213 0.07
214 0.08
215 0.08
216 0.06
217 0.06
218 0.06
219 0.08
220 0.09
221 0.12
222 0.15
223 0.16
224 0.21
225 0.25
226 0.24
227 0.23
228 0.25
229 0.28
230 0.27
231 0.26
232 0.24
233 0.24
234 0.26
235 0.28
236 0.28
237 0.28
238 0.32
239 0.35
240 0.36
241 0.35
242 0.4
243 0.45
244 0.48
245 0.48
246 0.49
247 0.48
248 0.47
249 0.47
250 0.41
251 0.36
252 0.33
253 0.27
254 0.2
255 0.16
256 0.16
257 0.15
258 0.14
259 0.16
260 0.15
261 0.15
262 0.15
263 0.16
264 0.15
265 0.12
266 0.12
267 0.1
268 0.13
269 0.16
270 0.19
271 0.19
272 0.21
273 0.22
274 0.22
275 0.23
276 0.18
277 0.15
278 0.12
279 0.12
280 0.1
281 0.09
282 0.08
283 0.06
284 0.06
285 0.06
286 0.06
287 0.05
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.05
300 0.06
301 0.08
302 0.14
303 0.14
304 0.16
305 0.2
306 0.2
307 0.21
308 0.28
309 0.34
310 0.39
311 0.48
312 0.57
313 0.63
314 0.72
315 0.82
316 0.84
317 0.88
318 0.88
319 0.89
320 0.88
321 0.86
322 0.83
323 0.74
324 0.71
325 0.66
326 0.58
327 0.49
328 0.4
329 0.32
330 0.33
331 0.31
332 0.25
333 0.22
334 0.19
335 0.18
336 0.18
337 0.18
338 0.13
339 0.12
340 0.11
341 0.12
342 0.13
343 0.15
344 0.21
345 0.23
346 0.26
347 0.3
348 0.33
349 0.39
350 0.47
351 0.52
352 0.55
353 0.63
354 0.62
355 0.64
356 0.64
357 0.57
358 0.51
359 0.52
360 0.52
361 0.43
362 0.44
363 0.44
364 0.46
365 0.49
366 0.57
367 0.57
368 0.53