Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YQP0

Protein Details
Accession A0A409YQP0    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRLRRSRAHHARRDVHRAARBasic
74-98ALKSHWRSKVHKRRCKQLREPAYTIHydrophilic
NLS Segment(s)
PositionSequence
5-21RRSRAHHARRDVHRAAR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRAHHARRDVHRAARTRVRGRDLDQIQLIDLDPKNRAALEKQAIDYEKPGLGQHYCVECAKYYESDEALKSHWRSKVHKRRCKQLREPAYTIEEAERAAGLGRENKRPTTASTSQEVTMTDDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.78
4 0.75
5 0.71
6 0.69
7 0.68
8 0.69
9 0.68
10 0.68
11 0.65
12 0.61
13 0.59
14 0.61
15 0.54
16 0.5
17 0.43
18 0.37
19 0.31
20 0.27
21 0.24
22 0.19
23 0.18
24 0.15
25 0.14
26 0.14
27 0.15
28 0.14
29 0.16
30 0.12
31 0.19
32 0.21
33 0.23
34 0.22
35 0.25
36 0.25
37 0.24
38 0.23
39 0.18
40 0.14
41 0.12
42 0.11
43 0.11
44 0.1
45 0.11
46 0.12
47 0.12
48 0.13
49 0.13
50 0.13
51 0.12
52 0.13
53 0.13
54 0.11
55 0.11
56 0.11
57 0.12
58 0.12
59 0.13
60 0.12
61 0.12
62 0.16
63 0.17
64 0.2
65 0.23
66 0.27
67 0.33
68 0.43
69 0.53
70 0.6
71 0.68
72 0.69
73 0.75
74 0.81
75 0.85
76 0.83
77 0.83
78 0.83
79 0.81
80 0.78
81 0.72
82 0.66
83 0.56
84 0.46
85 0.37
86 0.27
87 0.18
88 0.16
89 0.12
90 0.08
91 0.08
92 0.08
93 0.08
94 0.16
95 0.2
96 0.28
97 0.31
98 0.33
99 0.36
100 0.37
101 0.4
102 0.41
103 0.44
104 0.4
105 0.41
106 0.42
107 0.4
108 0.39
109 0.35