Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409YQ49

Protein Details
Accession A0A409YQ49    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-72LVDGVKKKATKRHRRRVSLFKMRRNVSHydrophilic
NLS Segment(s)
PositionSequence
50-64VKKKATKRHRRRVSL
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGAHPSSASTSRPGRGALSDAHPHSPTRITSTTRDSSALPRRRVSLVDGVKKKATKRHRRRVSLFKMRRNVSLES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.22
5 0.23
6 0.27
7 0.27
8 0.29
9 0.28
10 0.27
11 0.26
12 0.26
13 0.21
14 0.22
15 0.24
16 0.24
17 0.26
18 0.32
19 0.32
20 0.31
21 0.31
22 0.26
23 0.3
24 0.36
25 0.41
26 0.38
27 0.37
28 0.38
29 0.38
30 0.38
31 0.34
32 0.33
33 0.33
34 0.39
35 0.41
36 0.42
37 0.44
38 0.46
39 0.47
40 0.47
41 0.5
42 0.53
43 0.61
44 0.69
45 0.76
46 0.83
47 0.89
48 0.91
49 0.91
50 0.91
51 0.89
52 0.88
53 0.86
54 0.79
55 0.77