Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XJY3

Protein Details
Accession G7XJY3    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
91-113APTTPPKKTSKATKKTKKMESSSHydrophilic
123-144LTPACAPCKKAKRRCVHRSVIPHydrophilic
NLS Segment(s)
PositionSequence
97-107KKTSKATKKTK
156-171KKRKQTAEPGANPKRV
Subcellular Location(s) nucl 21, cyto_nucl 12.833, mito_nucl 11.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSSTEGGRLICPECRGFCDVSDTCPTCTAAESVILKAEISDSQDDTALKMAPSAEHSPQQANSEASSATAKAASAPQSPSAPQPPPAQPAPTTPPKKTSKATKKTKKMESSSDSNNSPKEKLTPACAPCKKAKRRCVHRSVIPDAEGQGASQPSKKRKQTAEPGANPKRVKKNDGDVSGNETGSEEGQRIKLKFKNVEYNTETGESTPKKRGRPSKTLPGNAEAGALPSIEEEDEEEEVPQKQAKDKNYGLPKDSLVAASRVTAFKHLDRQLQDKIADCEDKWKAAKDTVDEIRYILNKWIALWEQGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.31
4 0.29
5 0.28
6 0.33
7 0.3
8 0.31
9 0.38
10 0.36
11 0.33
12 0.34
13 0.34
14 0.26
15 0.27
16 0.23
17 0.15
18 0.19
19 0.19
20 0.17
21 0.18
22 0.17
23 0.15
24 0.15
25 0.15
26 0.11
27 0.13
28 0.14
29 0.13
30 0.14
31 0.16
32 0.16
33 0.16
34 0.16
35 0.14
36 0.12
37 0.12
38 0.12
39 0.1
40 0.15
41 0.19
42 0.2
43 0.22
44 0.25
45 0.26
46 0.28
47 0.3
48 0.28
49 0.24
50 0.22
51 0.2
52 0.18
53 0.16
54 0.15
55 0.13
56 0.1
57 0.09
58 0.09
59 0.09
60 0.11
61 0.13
62 0.15
63 0.17
64 0.18
65 0.2
66 0.21
67 0.24
68 0.26
69 0.25
70 0.26
71 0.3
72 0.32
73 0.35
74 0.36
75 0.34
76 0.3
77 0.33
78 0.36
79 0.4
80 0.42
81 0.39
82 0.45
83 0.48
84 0.52
85 0.53
86 0.58
87 0.59
88 0.64
89 0.74
90 0.76
91 0.8
92 0.85
93 0.88
94 0.86
95 0.8
96 0.78
97 0.72
98 0.68
99 0.64
100 0.59
101 0.52
102 0.46
103 0.44
104 0.37
105 0.32
106 0.27
107 0.24
108 0.24
109 0.23
110 0.26
111 0.3
112 0.32
113 0.41
114 0.43
115 0.43
116 0.47
117 0.56
118 0.61
119 0.62
120 0.68
121 0.69
122 0.77
123 0.83
124 0.84
125 0.81
126 0.77
127 0.75
128 0.7
129 0.62
130 0.52
131 0.42
132 0.34
133 0.28
134 0.21
135 0.14
136 0.1
137 0.09
138 0.08
139 0.12
140 0.15
141 0.21
142 0.29
143 0.33
144 0.38
145 0.43
146 0.51
147 0.57
148 0.64
149 0.67
150 0.65
151 0.72
152 0.71
153 0.72
154 0.65
155 0.61
156 0.6
157 0.53
158 0.5
159 0.44
160 0.48
161 0.49
162 0.52
163 0.49
164 0.4
165 0.43
166 0.4
167 0.36
168 0.26
169 0.19
170 0.15
171 0.13
172 0.12
173 0.07
174 0.06
175 0.1
176 0.14
177 0.14
178 0.2
179 0.22
180 0.28
181 0.34
182 0.37
183 0.45
184 0.43
185 0.5
186 0.47
187 0.46
188 0.41
189 0.36
190 0.32
191 0.22
192 0.26
193 0.21
194 0.22
195 0.29
196 0.33
197 0.36
198 0.45
199 0.54
200 0.56
201 0.64
202 0.68
203 0.7
204 0.74
205 0.76
206 0.7
207 0.64
208 0.57
209 0.47
210 0.4
211 0.29
212 0.21
213 0.14
214 0.11
215 0.08
216 0.06
217 0.06
218 0.05
219 0.05
220 0.05
221 0.07
222 0.08
223 0.08
224 0.08
225 0.1
226 0.11
227 0.12
228 0.13
229 0.13
230 0.18
231 0.24
232 0.28
233 0.35
234 0.38
235 0.46
236 0.53
237 0.56
238 0.53
239 0.5
240 0.46
241 0.39
242 0.37
243 0.3
244 0.22
245 0.19
246 0.16
247 0.15
248 0.17
249 0.16
250 0.16
251 0.18
252 0.2
253 0.22
254 0.3
255 0.34
256 0.38
257 0.41
258 0.46
259 0.48
260 0.49
261 0.48
262 0.43
263 0.42
264 0.4
265 0.39
266 0.33
267 0.36
268 0.33
269 0.37
270 0.36
271 0.37
272 0.36
273 0.38
274 0.42
275 0.38
276 0.44
277 0.45
278 0.45
279 0.39
280 0.37
281 0.37
282 0.35
283 0.32
284 0.28
285 0.24
286 0.23
287 0.23
288 0.28
289 0.24
290 0.28