Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WSL7

Protein Details
Accession A0A409WSL7    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
7-27SDKDRDREKGKEKEKDREKDRBasic
NLS Segment(s)
PositionSequence
11-53RDREKGKEKEKDREKDREKGKEKEKVKVKDREKGKERERERER
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MSGMDRSDKDRDREKGKEKEKDREKDREKGKEKEKVKVKDREKGKERERERERVQRDEHEGDSDEHQAMDVPLASGSTSIVSPFPIFLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.73
4 0.77
5 0.75
6 0.78
7 0.8
8 0.81
9 0.79
10 0.79
11 0.75
12 0.74
13 0.76
14 0.76
15 0.73
16 0.72
17 0.73
18 0.71
19 0.69
20 0.69
21 0.69
22 0.68
23 0.69
24 0.7
25 0.66
26 0.65
27 0.69
28 0.7
29 0.67
30 0.67
31 0.66
32 0.66
33 0.65
34 0.68
35 0.67
36 0.66
37 0.66
38 0.66
39 0.63
40 0.61
41 0.61
42 0.55
43 0.56
44 0.51
45 0.45
46 0.38
47 0.35
48 0.3
49 0.28
50 0.25
51 0.19
52 0.15
53 0.14
54 0.12
55 0.1
56 0.09
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.09