Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VGK7

Protein Details
Accession A0A409VGK7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-138ASCLKLCQKKVLTRKNKKKVGKSVYNQPKYEHydrophilic
NLS Segment(s)
PositionSequence
122-126KNKKK
Subcellular Location(s) mito 12, cyto 10, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009346  GRIM-19  
Gene Ontology GO:0005747  C:mitochondrial respiratory chain complex I  
Pfam View protein in Pfam  
PF06212  GRIM-19  
Amino Acid Sequences MIIVAQPYRQDMPPAGGFGAIKYKRNLPYKGPGAYVILGGVTAICAYGFYRLGKGNLERRELQREKVWSRIHLVPLLMAEGDRKAYAQQQAGLKLEQEIMKDVPGWEASCLKLCQKKVLTRKNKKKVGKSVYNQPKYEIQDLRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.2
4 0.19
5 0.18
6 0.26
7 0.23
8 0.24
9 0.25
10 0.32
11 0.39
12 0.46
13 0.49
14 0.45
15 0.52
16 0.55
17 0.56
18 0.5
19 0.43
20 0.38
21 0.35
22 0.29
23 0.19
24 0.12
25 0.09
26 0.07
27 0.06
28 0.03
29 0.03
30 0.02
31 0.02
32 0.03
33 0.03
34 0.05
35 0.07
36 0.07
37 0.09
38 0.11
39 0.12
40 0.14
41 0.19
42 0.25
43 0.28
44 0.31
45 0.33
46 0.35
47 0.44
48 0.43
49 0.41
50 0.38
51 0.4
52 0.39
53 0.43
54 0.42
55 0.33
56 0.36
57 0.36
58 0.33
59 0.27
60 0.25
61 0.17
62 0.16
63 0.15
64 0.09
65 0.06
66 0.05
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.09
73 0.12
74 0.13
75 0.17
76 0.19
77 0.21
78 0.23
79 0.22
80 0.19
81 0.16
82 0.18
83 0.15
84 0.13
85 0.13
86 0.12
87 0.12
88 0.13
89 0.12
90 0.11
91 0.11
92 0.11
93 0.1
94 0.11
95 0.12
96 0.15
97 0.16
98 0.21
99 0.25
100 0.26
101 0.33
102 0.38
103 0.46
104 0.53
105 0.63
106 0.69
107 0.74
108 0.84
109 0.87
110 0.9
111 0.9
112 0.9
113 0.9
114 0.89
115 0.88
116 0.84
117 0.85
118 0.86
119 0.85
120 0.76
121 0.69
122 0.66
123 0.61
124 0.62
125 0.55