Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VJS5

Protein Details
Accession A0A409VJS5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
52-80GEGGREGGRRRRRRGGRRARRKDKATSPLBasic
NLS Segment(s)
PositionSequence
54-75GGREGGRRRRRRGGRRARRKDK
Subcellular Location(s) plas 13, nucl 9.5, cyto_nucl 5.5, golg 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MSSNLSQQSHSNTATSTKSYDERLESAGMRPSPVNDDLDNVTEDSTIERNGGEGGREGGRRRRRRGGRRARRKDKATSPLVKDDNEESVEDRENGDVKVVPMMGDENNDGIAGDLRGEGPLEFVAVPHLVSLPIVVAPLAIDPPIVIVPPTAIVPPIVVVPPIVVVPPIDTDAFELGEVVWALPVSLEEVKVRSLNSRTGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.24
4 0.22
5 0.24
6 0.27
7 0.3
8 0.29
9 0.28
10 0.28
11 0.3
12 0.27
13 0.27
14 0.3
15 0.26
16 0.24
17 0.23
18 0.22
19 0.24
20 0.25
21 0.25
22 0.19
23 0.21
24 0.21
25 0.22
26 0.22
27 0.17
28 0.15
29 0.12
30 0.12
31 0.11
32 0.11
33 0.09
34 0.08
35 0.08
36 0.08
37 0.09
38 0.1
39 0.08
40 0.08
41 0.1
42 0.12
43 0.15
44 0.18
45 0.25
46 0.35
47 0.43
48 0.5
49 0.58
50 0.65
51 0.74
52 0.82
53 0.85
54 0.86
55 0.89
56 0.93
57 0.93
58 0.92
59 0.87
60 0.85
61 0.82
62 0.79
63 0.76
64 0.72
65 0.65
66 0.64
67 0.6
68 0.52
69 0.44
70 0.37
71 0.3
72 0.24
73 0.2
74 0.14
75 0.14
76 0.14
77 0.13
78 0.12
79 0.1
80 0.1
81 0.09
82 0.09
83 0.08
84 0.07
85 0.07
86 0.07
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.04
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.04
110 0.04
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03
130 0.04
131 0.05
132 0.05
133 0.04
134 0.04
135 0.05
136 0.05
137 0.06
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.05
153 0.06
154 0.07
155 0.09
156 0.09
157 0.09
158 0.1
159 0.11
160 0.11
161 0.1
162 0.09
163 0.07
164 0.08
165 0.08
166 0.07
167 0.06
168 0.06
169 0.06
170 0.05
171 0.06
172 0.07
173 0.08
174 0.1
175 0.11
176 0.12
177 0.15
178 0.17
179 0.18
180 0.21
181 0.23
182 0.31