Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409Y6B2

Protein Details
Accession A0A409Y6B2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPRRRCPTCGSKQWHKEPASHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 9.5, cyto_mito 6, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR033599  TAF1B/Rrn7  
Gene Ontology GO:0070860  C:RNA polymerase I core factor complex  
GO:0046872  F:metal ion binding  
GO:0001164  F:RNA polymerase I core promoter sequence-specific DNA binding  
Amino Acid Sequences MAPRRRCPTCGSKQWHKEPASGLIACSEGHILQLIFRKQVSTLIDVWRLPAEFEVICRDLWALNLALLPDPPSAEPYDFSQENKTGKEENAQSQSGDAQKRKANVSQSGEAAGSDSDHEGEDATNVIKDEEISNAPEDVDDDDDDELDELMRENSEISSTSDDDQEEKGGVDGETATNTKSGKRRGRLMYESPACTIAVLMVACWTLRLPIMYRDLTRLIERYELPYLEGLRMLPESMAQHLTKHNVQALSPAHAPKTMTIHSLASRFGKKLYQCYGIYTPEANAADILWRLTKSMGGTPLLYVVTKRVMSVVSAPLTLHGSLAPVLQTKRSWEAKRNQYDNAPVEVSLIAAMIVGLKMIYGLDGRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.79
4 0.73
5 0.66
6 0.64
7 0.6
8 0.51
9 0.41
10 0.33
11 0.31
12 0.26
13 0.23
14 0.17
15 0.1
16 0.1
17 0.11
18 0.09
19 0.12
20 0.2
21 0.21
22 0.22
23 0.22
24 0.23
25 0.21
26 0.27
27 0.26
28 0.23
29 0.25
30 0.28
31 0.31
32 0.3
33 0.31
34 0.29
35 0.26
36 0.22
37 0.19
38 0.16
39 0.12
40 0.14
41 0.18
42 0.16
43 0.16
44 0.16
45 0.16
46 0.13
47 0.14
48 0.15
49 0.09
50 0.09
51 0.1
52 0.1
53 0.1
54 0.1
55 0.11
56 0.1
57 0.1
58 0.1
59 0.11
60 0.13
61 0.13
62 0.14
63 0.16
64 0.22
65 0.21
66 0.23
67 0.25
68 0.28
69 0.3
70 0.3
71 0.3
72 0.26
73 0.26
74 0.32
75 0.32
76 0.34
77 0.36
78 0.36
79 0.33
80 0.31
81 0.33
82 0.32
83 0.34
84 0.29
85 0.29
86 0.31
87 0.35
88 0.37
89 0.38
90 0.38
91 0.4
92 0.44
93 0.41
94 0.39
95 0.37
96 0.34
97 0.29
98 0.23
99 0.15
100 0.1
101 0.07
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.08
118 0.09
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.08
126 0.09
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.06
144 0.07
145 0.09
146 0.1
147 0.11
148 0.12
149 0.12
150 0.13
151 0.12
152 0.11
153 0.09
154 0.08
155 0.08
156 0.07
157 0.07
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.06
164 0.07
165 0.07
166 0.11
167 0.16
168 0.24
169 0.31
170 0.34
171 0.42
172 0.46
173 0.52
174 0.54
175 0.53
176 0.53
177 0.5
178 0.47
179 0.4
180 0.36
181 0.28
182 0.23
183 0.18
184 0.09
185 0.07
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.06
197 0.09
198 0.14
199 0.15
200 0.16
201 0.18
202 0.2
203 0.2
204 0.2
205 0.18
206 0.15
207 0.16
208 0.16
209 0.17
210 0.17
211 0.16
212 0.16
213 0.16
214 0.16
215 0.13
216 0.13
217 0.1
218 0.09
219 0.09
220 0.08
221 0.06
222 0.07
223 0.07
224 0.09
225 0.12
226 0.11
227 0.13
228 0.15
229 0.19
230 0.19
231 0.2
232 0.22
233 0.2
234 0.19
235 0.24
236 0.23
237 0.23
238 0.24
239 0.24
240 0.21
241 0.22
242 0.22
243 0.18
244 0.22
245 0.19
246 0.18
247 0.18
248 0.2
249 0.21
250 0.21
251 0.22
252 0.22
253 0.23
254 0.22
255 0.22
256 0.25
257 0.25
258 0.31
259 0.34
260 0.36
261 0.33
262 0.38
263 0.4
264 0.37
265 0.37
266 0.3
267 0.26
268 0.24
269 0.24
270 0.19
271 0.15
272 0.13
273 0.13
274 0.12
275 0.13
276 0.09
277 0.09
278 0.1
279 0.1
280 0.12
281 0.12
282 0.16
283 0.18
284 0.18
285 0.18
286 0.18
287 0.19
288 0.18
289 0.16
290 0.13
291 0.12
292 0.15
293 0.14
294 0.14
295 0.13
296 0.13
297 0.14
298 0.18
299 0.2
300 0.17
301 0.18
302 0.18
303 0.18
304 0.2
305 0.18
306 0.15
307 0.1
308 0.1
309 0.1
310 0.11
311 0.11
312 0.13
313 0.14
314 0.17
315 0.18
316 0.22
317 0.29
318 0.37
319 0.42
320 0.47
321 0.56
322 0.64
323 0.73
324 0.73
325 0.7
326 0.67
327 0.7
328 0.64
329 0.58
330 0.49
331 0.38
332 0.35
333 0.3
334 0.25
335 0.16
336 0.12
337 0.07
338 0.05
339 0.05
340 0.04
341 0.04
342 0.04
343 0.04
344 0.03
345 0.04
346 0.04
347 0.05
348 0.05