Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VZJ5

Protein Details
Accession A0A409VZJ5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-123EHEHDAPRSKGKKKKGKGKGFFKSVVGBasic
NLS Segment(s)
PositionSequence
103-116PRSKGKKKKGKGKG
Subcellular Location(s) extr 22, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKLFTASQLTVAVVLVTAVVQGLPLDIQESGTSSDINIPHLFYRQPQLYERQDIENRGLGFLSFLDPVLNIGKSLIKGVLSPSDSGGTEEKEYHPHEHEHDAPRSKGKKKKGKGKGFFKSVVGALLGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.05
15 0.05
16 0.07
17 0.08
18 0.09
19 0.09
20 0.08
21 0.12
22 0.12
23 0.15
24 0.14
25 0.13
26 0.14
27 0.15
28 0.16
29 0.13
30 0.19
31 0.19
32 0.21
33 0.22
34 0.28
35 0.3
36 0.35
37 0.35
38 0.34
39 0.34
40 0.33
41 0.33
42 0.29
43 0.25
44 0.21
45 0.19
46 0.13
47 0.11
48 0.1
49 0.09
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.05
58 0.06
59 0.07
60 0.07
61 0.08
62 0.07
63 0.06
64 0.06
65 0.08
66 0.11
67 0.11
68 0.11
69 0.12
70 0.12
71 0.12
72 0.14
73 0.14
74 0.12
75 0.12
76 0.14
77 0.14
78 0.18
79 0.2
80 0.22
81 0.23
82 0.24
83 0.26
84 0.3
85 0.36
86 0.38
87 0.42
88 0.44
89 0.44
90 0.5
91 0.55
92 0.58
93 0.59
94 0.63
95 0.67
96 0.72
97 0.8
98 0.82
99 0.86
100 0.88
101 0.91
102 0.9
103 0.87
104 0.8
105 0.71
106 0.63
107 0.53
108 0.44
109 0.33