Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VNK6

Protein Details
Accession A0A409VNK6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAQRVQLRKRKSYNTTSNRRRVVKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVQLRKRKSYNTTSNRRRVVKTPGGKLVYHHLKKLGSAPKCGDCGLALAGVPALRPREYATVSKRRKTVQRAYGGSRCGDCVRDRIVRSFLLEEAKIVKKVIKQQQKTSAARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.86
5 0.85
6 0.82
7 0.76
8 0.71
9 0.7
10 0.69
11 0.67
12 0.64
13 0.63
14 0.61
15 0.56
16 0.52
17 0.52
18 0.53
19 0.46
20 0.41
21 0.36
22 0.34
23 0.34
24 0.41
25 0.39
26 0.31
27 0.33
28 0.35
29 0.34
30 0.35
31 0.35
32 0.27
33 0.19
34 0.17
35 0.13
36 0.1
37 0.07
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.08
47 0.11
48 0.13
49 0.19
50 0.25
51 0.34
52 0.39
53 0.43
54 0.45
55 0.47
56 0.53
57 0.56
58 0.58
59 0.56
60 0.6
61 0.6
62 0.64
63 0.63
64 0.57
65 0.5
66 0.41
67 0.35
68 0.27
69 0.25
70 0.2
71 0.19
72 0.23
73 0.27
74 0.29
75 0.31
76 0.32
77 0.31
78 0.32
79 0.3
80 0.27
81 0.25
82 0.23
83 0.2
84 0.22
85 0.25
86 0.23
87 0.22
88 0.24
89 0.24
90 0.34
91 0.43
92 0.49
93 0.53
94 0.61
95 0.71
96 0.77