Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VE15

Protein Details
Accession A0A409VE15    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-51PSHIPACAPKPARRKRQQQPTPQELSSHydrophilic
250-273DSEPRLPIRRSKRTTTRGKGRGKKBasic
NLS Segment(s)
PositionSequence
212-273GRRTPLVRSPYKLRKRPLETIPSLAPPPKRPRTSRTQADSEPRLPIRRSKRTTTRGKGRGKK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSQATTLVKDSDQTINDGQNAQAGPSHIPACAPKPARRKRQQQPTPQELSSLGIKVRDFAYESKLPPVKTVYRQPKQVQPSSQAESQGPKPLERTLTEPVIEPERQPGAYALADIGIADAGTQDGTPMVVDPPRSFAPKPLSRALQPTVMAVRTSTPAPQPIFMVPTSPAQPQGTLSAPLPPSSPDPFSRSQAGLHQTLSRHNSRQICAPKGRRTPLVRSPYKLRKRPLETIPSLAPPPKRPRTSRTQADSEPRLPIRRSKRTTTRGKGRGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.27
5 0.24
6 0.22
7 0.21
8 0.18
9 0.17
10 0.16
11 0.16
12 0.18
13 0.19
14 0.15
15 0.16
16 0.19
17 0.2
18 0.27
19 0.31
20 0.36
21 0.46
22 0.56
23 0.66
24 0.73
25 0.8
26 0.82
27 0.88
28 0.9
29 0.9
30 0.9
31 0.88
32 0.84
33 0.74
34 0.65
35 0.54
36 0.47
37 0.38
38 0.29
39 0.21
40 0.17
41 0.17
42 0.17
43 0.17
44 0.15
45 0.15
46 0.15
47 0.21
48 0.23
49 0.24
50 0.31
51 0.34
52 0.32
53 0.32
54 0.36
55 0.35
56 0.37
57 0.46
58 0.49
59 0.51
60 0.59
61 0.61
62 0.64
63 0.66
64 0.67
65 0.61
66 0.56
67 0.56
68 0.53
69 0.5
70 0.44
71 0.38
72 0.35
73 0.33
74 0.33
75 0.28
76 0.24
77 0.24
78 0.25
79 0.26
80 0.24
81 0.26
82 0.23
83 0.24
84 0.24
85 0.23
86 0.22
87 0.23
88 0.22
89 0.18
90 0.17
91 0.16
92 0.16
93 0.15
94 0.14
95 0.12
96 0.12
97 0.12
98 0.08
99 0.07
100 0.07
101 0.06
102 0.05
103 0.03
104 0.03
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.03
113 0.03
114 0.03
115 0.04
116 0.05
117 0.06
118 0.06
119 0.1
120 0.11
121 0.14
122 0.14
123 0.18
124 0.25
125 0.29
126 0.33
127 0.33
128 0.34
129 0.32
130 0.36
131 0.33
132 0.28
133 0.24
134 0.21
135 0.19
136 0.17
137 0.16
138 0.12
139 0.11
140 0.09
141 0.1
142 0.1
143 0.1
144 0.14
145 0.14
146 0.15
147 0.15
148 0.15
149 0.16
150 0.15
151 0.15
152 0.11
153 0.13
154 0.15
155 0.14
156 0.16
157 0.14
158 0.14
159 0.14
160 0.15
161 0.15
162 0.14
163 0.14
164 0.16
165 0.16
166 0.16
167 0.16
168 0.15
169 0.17
170 0.18
171 0.21
172 0.18
173 0.23
174 0.26
175 0.28
176 0.3
177 0.27
178 0.26
179 0.28
180 0.3
181 0.27
182 0.25
183 0.25
184 0.23
185 0.28
186 0.32
187 0.31
188 0.3
189 0.35
190 0.38
191 0.37
192 0.45
193 0.47
194 0.49
195 0.54
196 0.59
197 0.62
198 0.66
199 0.69
200 0.68
201 0.66
202 0.67
203 0.68
204 0.69
205 0.65
206 0.62
207 0.67
208 0.7
209 0.75
210 0.74
211 0.73
212 0.73
213 0.75
214 0.78
215 0.78
216 0.77
217 0.7
218 0.67
219 0.62
220 0.55
221 0.5
222 0.47
223 0.42
224 0.41
225 0.48
226 0.52
227 0.58
228 0.6
229 0.64
230 0.7
231 0.76
232 0.77
233 0.75
234 0.73
235 0.71
236 0.75
237 0.75
238 0.67
239 0.65
240 0.59
241 0.58
242 0.53
243 0.55
244 0.56
245 0.6
246 0.64
247 0.67
248 0.73
249 0.77
250 0.85
251 0.86
252 0.87
253 0.86