Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409V9W7

Protein Details
Accession A0A409V9W7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSQSKPQPQPPKKKLSTPPQSLLHydrophilic
65-84LSKPSKKLYRRLLRAHRNLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.5, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MPSQSKPQPQPPKKKLSTPPQSLLLVPKKNIEPVKRDEIDEFGDINITIVPPTPTPGASNSGIPLSKPSKKLYRRLLRAHRNLPADMRPLGDGYVKSEFRRHKEVTNPAHIIGFLSQWKMYLDQIPEGPNASNFAGKRLDPTVFEKLSNEQLGQLYEVMHAAKDVWKPISELEQGAEAEKESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.84
5 0.81
6 0.76
7 0.71
8 0.67
9 0.58
10 0.58
11 0.55
12 0.5
13 0.42
14 0.42
15 0.38
16 0.44
17 0.49
18 0.45
19 0.43
20 0.44
21 0.52
22 0.49
23 0.49
24 0.44
25 0.4
26 0.37
27 0.32
28 0.26
29 0.17
30 0.15
31 0.14
32 0.13
33 0.1
34 0.07
35 0.05
36 0.06
37 0.07
38 0.07
39 0.09
40 0.09
41 0.1
42 0.11
43 0.13
44 0.16
45 0.16
46 0.16
47 0.15
48 0.16
49 0.16
50 0.15
51 0.18
52 0.19
53 0.23
54 0.25
55 0.29
56 0.37
57 0.43
58 0.52
59 0.57
60 0.62
61 0.65
62 0.72
63 0.77
64 0.78
65 0.8
66 0.76
67 0.71
68 0.64
69 0.57
70 0.49
71 0.42
72 0.34
73 0.27
74 0.22
75 0.17
76 0.14
77 0.14
78 0.13
79 0.1
80 0.1
81 0.14
82 0.14
83 0.14
84 0.2
85 0.24
86 0.27
87 0.34
88 0.33
89 0.33
90 0.4
91 0.49
92 0.49
93 0.52
94 0.49
95 0.42
96 0.4
97 0.36
98 0.29
99 0.2
100 0.15
101 0.09
102 0.09
103 0.09
104 0.09
105 0.1
106 0.1
107 0.11
108 0.13
109 0.14
110 0.14
111 0.16
112 0.17
113 0.17
114 0.17
115 0.16
116 0.12
117 0.14
118 0.13
119 0.15
120 0.13
121 0.16
122 0.17
123 0.17
124 0.2
125 0.2
126 0.2
127 0.19
128 0.25
129 0.29
130 0.28
131 0.28
132 0.27
133 0.28
134 0.32
135 0.31
136 0.26
137 0.2
138 0.2
139 0.21
140 0.2
141 0.17
142 0.12
143 0.11
144 0.12
145 0.1
146 0.08
147 0.08
148 0.08
149 0.12
150 0.14
151 0.17
152 0.19
153 0.19
154 0.2
155 0.22
156 0.28
157 0.25
158 0.24
159 0.22
160 0.23
161 0.22
162 0.22
163 0.21