Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YPQ8

Protein Details
Accession A0A409YPQ8    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-109INPPPKPPSDTEKKRKQRPLPVPRQKQAKSHydrophilic
NLS Segment(s)
PositionSequence
15-22RRKIKERI
91-109EKKRKQRPLPVPRQKQAKS
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MEEVRQVTQHRASERRKIKERIGYKKEKMDEAWKLHQWGLDAGHHQDDWNPYFGLPNLWVVSDHMYDDDLIQIGPNYVEINPPPKPPSDTEKKRKQRPLPVPRQKQAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.71
4 0.72
5 0.73
6 0.74
7 0.78
8 0.79
9 0.79
10 0.79
11 0.75
12 0.77
13 0.72
14 0.65
15 0.58
16 0.55
17 0.54
18 0.5
19 0.51
20 0.45
21 0.44
22 0.42
23 0.4
24 0.32
25 0.26
26 0.22
27 0.17
28 0.16
29 0.15
30 0.15
31 0.14
32 0.13
33 0.14
34 0.15
35 0.14
36 0.15
37 0.13
38 0.12
39 0.13
40 0.13
41 0.12
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.08
48 0.1
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.05
63 0.05
64 0.05
65 0.07
66 0.08
67 0.13
68 0.15
69 0.19
70 0.2
71 0.22
72 0.25
73 0.27
74 0.35
75 0.41
76 0.5
77 0.57
78 0.67
79 0.75
80 0.82
81 0.88
82 0.89
83 0.89
84 0.9
85 0.91
86 0.91
87 0.92
88 0.92
89 0.9