Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409Y7F9

Protein Details
Accession A0A409Y7F9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
169-203EFLEKHPEKAPKKVQKKEKKDKKQDKGSSKEKTATBasic
NLS Segment(s)
PositionSequence
149-200LKERREKAAKALKGQPVFLKEFLEKHPEKAPKKVQKKEKKDKKQDKGSSKEK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.333, mito 7.5, cyto_mito 6.833, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040049  MRPS25  
IPR007741  Ribosome/NADH_DH  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF05047  L51_S25_CI-B8  
Amino Acid Sequences MPPKAETLPQGIIKLSKLLTHLKASPKLTLNGVKALRLSYAYQNDHFGARHFVANDLPRIRFANPDLQIQVDRVRKTKEDNWAAAMELEFNDGKSHKVDISDKWSTSILKEIMDKAGGDPWKAHVAEAKAAGLPVLPGEDTYLKEEERLKERREKAAKALKGQPVFLKEFLEKHPEKAPKKVQKKEKKDKKQDKGSSKEKTAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.19
4 0.19
5 0.25
6 0.27
7 0.3
8 0.34
9 0.39
10 0.45
11 0.45
12 0.48
13 0.45
14 0.44
15 0.44
16 0.45
17 0.39
18 0.4
19 0.39
20 0.34
21 0.31
22 0.3
23 0.25
24 0.21
25 0.21
26 0.21
27 0.27
28 0.29
29 0.29
30 0.31
31 0.31
32 0.31
33 0.29
34 0.23
35 0.21
36 0.19
37 0.2
38 0.17
39 0.18
40 0.2
41 0.22
42 0.26
43 0.24
44 0.23
45 0.23
46 0.25
47 0.24
48 0.23
49 0.23
50 0.26
51 0.25
52 0.28
53 0.26
54 0.26
55 0.25
56 0.24
57 0.28
58 0.24
59 0.24
60 0.25
61 0.27
62 0.27
63 0.33
64 0.36
65 0.39
66 0.4
67 0.39
68 0.39
69 0.36
70 0.35
71 0.29
72 0.24
73 0.14
74 0.09
75 0.09
76 0.07
77 0.06
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.08
84 0.11
85 0.13
86 0.14
87 0.21
88 0.22
89 0.22
90 0.22
91 0.22
92 0.2
93 0.18
94 0.2
95 0.14
96 0.12
97 0.13
98 0.13
99 0.13
100 0.13
101 0.12
102 0.09
103 0.12
104 0.12
105 0.11
106 0.11
107 0.12
108 0.16
109 0.16
110 0.16
111 0.15
112 0.16
113 0.17
114 0.18
115 0.16
116 0.12
117 0.12
118 0.12
119 0.08
120 0.07
121 0.04
122 0.04
123 0.04
124 0.03
125 0.06
126 0.07
127 0.08
128 0.11
129 0.13
130 0.12
131 0.15
132 0.19
133 0.22
134 0.28
135 0.33
136 0.35
137 0.43
138 0.48
139 0.55
140 0.58
141 0.56
142 0.59
143 0.62
144 0.63
145 0.6
146 0.63
147 0.6
148 0.55
149 0.54
150 0.48
151 0.43
152 0.42
153 0.37
154 0.32
155 0.27
156 0.28
157 0.29
158 0.35
159 0.31
160 0.31
161 0.38
162 0.44
163 0.46
164 0.53
165 0.6
166 0.62
167 0.72
168 0.78
169 0.81
170 0.83
171 0.9
172 0.92
173 0.93
174 0.93
175 0.94
176 0.96
177 0.96
178 0.96
179 0.95
180 0.94
181 0.92
182 0.91
183 0.88