Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409YF25

Protein Details
Accession A0A409YF25    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-140TIPATPTSRKPKPKKKDEVEKVSFHydrophilic
235-257REQVPPFRYRLRRRGERNLKSKSBasic
NLS Segment(s)
PositionSequence
93-132RKAYAKSEPLRRNPPRPLRRQARVTIPATPTSRKPKPKKK
244-256RLRRRGERNLKSK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSPSRTKRNAESTSYSNMDIDTRPIPETPLKGVMLTKPLDDTAQMYESDKGSPLYSPRRSGRNAIPRTQGSPSPSIDRRRVGGPSPEELEESRKAYAKSEPLRRNPPRPLRRQARVTIPATPTSRKPKPKKKDEVEKVSFLSRDKVKRVHSDIEDSDDELPVYHKPKRMKRTPSSSSREAFTANLTTREQGKRARDSEEDAEDEADPLPSHRAKRMRLAESSKVVTDSNSQKPEREQVPPFRYRLRRRGERNLKSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.49
3 0.39
4 0.34
5 0.29
6 0.23
7 0.23
8 0.18
9 0.18
10 0.19
11 0.19
12 0.22
13 0.24
14 0.26
15 0.26
16 0.29
17 0.27
18 0.27
19 0.28
20 0.27
21 0.28
22 0.26
23 0.23
24 0.19
25 0.19
26 0.19
27 0.17
28 0.17
29 0.14
30 0.15
31 0.15
32 0.15
33 0.17
34 0.17
35 0.17
36 0.16
37 0.14
38 0.13
39 0.14
40 0.19
41 0.26
42 0.3
43 0.36
44 0.4
45 0.45
46 0.48
47 0.52
48 0.55
49 0.57
50 0.58
51 0.56
52 0.59
53 0.54
54 0.54
55 0.51
56 0.45
57 0.38
58 0.36
59 0.33
60 0.33
61 0.37
62 0.4
63 0.42
64 0.4
65 0.39
66 0.38
67 0.38
68 0.35
69 0.36
70 0.33
71 0.31
72 0.31
73 0.3
74 0.28
75 0.26
76 0.27
77 0.21
78 0.2
79 0.18
80 0.19
81 0.18
82 0.19
83 0.22
84 0.26
85 0.32
86 0.4
87 0.46
88 0.5
89 0.61
90 0.65
91 0.68
92 0.7
93 0.73
94 0.73
95 0.74
96 0.77
97 0.75
98 0.77
99 0.75
100 0.7
101 0.67
102 0.65
103 0.58
104 0.53
105 0.46
106 0.43
107 0.39
108 0.37
109 0.34
110 0.35
111 0.41
112 0.46
113 0.54
114 0.6
115 0.68
116 0.77
117 0.82
118 0.83
119 0.87
120 0.86
121 0.87
122 0.8
123 0.72
124 0.63
125 0.54
126 0.46
127 0.36
128 0.31
129 0.26
130 0.26
131 0.27
132 0.31
133 0.33
134 0.39
135 0.43
136 0.44
137 0.4
138 0.42
139 0.39
140 0.38
141 0.34
142 0.29
143 0.24
144 0.19
145 0.17
146 0.11
147 0.12
148 0.09
149 0.13
150 0.15
151 0.2
152 0.28
153 0.37
154 0.47
155 0.55
156 0.63
157 0.68
158 0.75
159 0.78
160 0.8
161 0.79
162 0.75
163 0.67
164 0.58
165 0.5
166 0.41
167 0.33
168 0.26
169 0.23
170 0.19
171 0.2
172 0.19
173 0.2
174 0.25
175 0.27
176 0.28
177 0.3
178 0.35
179 0.4
180 0.42
181 0.45
182 0.41
183 0.44
184 0.45
185 0.42
186 0.37
187 0.3
188 0.29
189 0.24
190 0.23
191 0.17
192 0.13
193 0.09
194 0.09
195 0.13
196 0.15
197 0.18
198 0.24
199 0.31
200 0.34
201 0.44
202 0.52
203 0.53
204 0.57
205 0.62
206 0.62
207 0.61
208 0.6
209 0.51
210 0.43
211 0.38
212 0.31
213 0.32
214 0.32
215 0.35
216 0.4
217 0.4
218 0.41
219 0.45
220 0.52
221 0.49
222 0.5
223 0.49
224 0.52
225 0.6
226 0.63
227 0.64
228 0.65
229 0.71
230 0.73
231 0.74
232 0.74
233 0.76
234 0.79
235 0.87
236 0.88
237 0.88