Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YBU7

Protein Details
Accession A0A409YBU7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
24-51QPTAQAPKKPPGRPRKSKPTPGKENTIPHydrophilic
NLS Segment(s)
PositionSequence
27-45AQAPKKPPGRPRKSKPTPG
122-127PKKKGK
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MARPSSKKPLKETAVSPAAPKTPQPTAQAPKKPPGRPRKSKPTPGKENTIPSSPLGSGASGPPATSSSDDLQLNLANITNIKLLRKHIAELEADGHTFYEEEVATDHEDTDEGLSPSSAPPPKKKGKWPHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.52
3 0.47
4 0.4
5 0.37
6 0.32
7 0.31
8 0.27
9 0.26
10 0.3
11 0.34
12 0.39
13 0.45
14 0.53
15 0.6
16 0.59
17 0.63
18 0.67
19 0.68
20 0.7
21 0.72
22 0.74
23 0.76
24 0.81
25 0.84
26 0.84
27 0.89
28 0.9
29 0.89
30 0.89
31 0.83
32 0.81
33 0.74
34 0.71
35 0.63
36 0.55
37 0.45
38 0.35
39 0.32
40 0.25
41 0.21
42 0.15
43 0.12
44 0.1
45 0.09
46 0.1
47 0.08
48 0.08
49 0.07
50 0.07
51 0.08
52 0.08
53 0.1
54 0.09
55 0.13
56 0.13
57 0.13
58 0.13
59 0.12
60 0.12
61 0.09
62 0.09
63 0.05
64 0.05
65 0.06
66 0.08
67 0.08
68 0.09
69 0.11
70 0.13
71 0.18
72 0.19
73 0.19
74 0.19
75 0.21
76 0.2
77 0.2
78 0.2
79 0.16
80 0.15
81 0.13
82 0.11
83 0.09
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.07
90 0.08
91 0.09
92 0.1
93 0.1
94 0.08
95 0.09
96 0.09
97 0.1
98 0.11
99 0.1
100 0.1
101 0.1
102 0.1
103 0.11
104 0.18
105 0.22
106 0.24
107 0.32
108 0.41
109 0.51
110 0.59
111 0.68
112 0.73