Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WE69

Protein Details
Accession A0A409WE69    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-37ETGRRRLQNNQLKRHYKRPQACRERASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
Amino Acid Sequences MRQKRETIGEETGRRRLQNNQLKRHYKRPQACRERASKQQREELKLRVQAPNERVKGNELTMSITHPSSLLHDLPQDMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.47
4 0.5
5 0.53
6 0.58
7 0.61
8 0.68
9 0.76
10 0.79
11 0.81
12 0.8
13 0.8
14 0.79
15 0.79
16 0.8
17 0.81
18 0.83
19 0.78
20 0.76
21 0.71
22 0.72
23 0.72
24 0.68
25 0.61
26 0.61
27 0.6
28 0.58
29 0.56
30 0.51
31 0.46
32 0.45
33 0.44
34 0.4
35 0.38
36 0.39
37 0.4
38 0.44
39 0.4
40 0.36
41 0.34
42 0.34
43 0.33
44 0.29
45 0.26
46 0.18
47 0.19
48 0.18
49 0.2
50 0.18
51 0.16
52 0.15
53 0.13
54 0.13
55 0.13
56 0.17
57 0.16
58 0.16
59 0.17