Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XXK4

Protein Details
Accession A0A409XXK4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAKSKNHTNHNQNKKAHRNGIKRPQRNRTRSLHydrophilic
NLS Segment(s)
PositionSequence
14-44KKAHRNGIKRPQRNRTRSLKGVDAKFRRNAR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKRPQRNRTRSLKGVDAKFRRNARFALIGSNRARAEAKAEAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.84
8 0.84
9 0.83
10 0.83
11 0.84
12 0.85
13 0.81
14 0.79
15 0.77
16 0.75
17 0.71
18 0.65
19 0.62
20 0.58
21 0.57
22 0.58
23 0.54
24 0.51
25 0.52
26 0.56
27 0.51
28 0.48
29 0.44
30 0.39
31 0.39
32 0.35
33 0.38
34 0.34
35 0.38
36 0.37
37 0.42
38 0.37
39 0.34
40 0.35
41 0.25
42 0.28
43 0.24