Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WB31

Protein Details
Accession A0A409WB31    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-26ASRSARPPSKLNRLVRKHPSLFHydrophilic
NLS Segment(s)
PositionSequence
69-72KRRK
Subcellular Location(s) mito 14.5, mito_nucl 8, plas 7, cyto 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020164  Cyt_c_Oxase_assmbl_COX16  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF14138  COX16  
Amino Acid Sequences MAVFASRSARPPSKLNRLVRKHPSLFGVPFCLLMVAASFGLTTFTQTRYDLHDKKVKNVSKEEELKLNKRRKKFDIREEYFRLSAGMEDDWEQKRIPRPAGVPEWGVPPSEPTSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.71
4 0.74
5 0.8
6 0.81
7 0.82
8 0.74
9 0.68
10 0.63
11 0.57
12 0.52
13 0.44
14 0.39
15 0.3
16 0.27
17 0.24
18 0.19
19 0.14
20 0.11
21 0.09
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.06
28 0.06
29 0.08
30 0.08
31 0.1
32 0.11
33 0.12
34 0.13
35 0.18
36 0.27
37 0.28
38 0.32
39 0.37
40 0.36
41 0.42
42 0.5
43 0.46
44 0.41
45 0.43
46 0.41
47 0.42
48 0.46
49 0.41
50 0.4
51 0.41
52 0.44
53 0.49
54 0.54
55 0.52
56 0.55
57 0.6
58 0.6
59 0.68
60 0.7
61 0.72
62 0.75
63 0.75
64 0.77
65 0.75
66 0.71
67 0.6
68 0.51
69 0.4
70 0.29
71 0.23
72 0.16
73 0.11
74 0.08
75 0.1
76 0.15
77 0.16
78 0.18
79 0.17
80 0.2
81 0.28
82 0.32
83 0.34
84 0.34
85 0.35
86 0.42
87 0.47
88 0.46
89 0.41
90 0.37
91 0.38
92 0.33
93 0.31
94 0.23
95 0.22
96 0.23