Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WWX9

Protein Details
Accession A0A409WWX9    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-85HYNTTLRKKRILRQYERVCRSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 10, cyto 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MFRQMCDTVAACHAQQVFHRDIKPEIFIVTDGTSTTPDGRLECKVIVKLTDFGLLTTDLYANVHYNTTLRKKRILRQYERVCRSSISVTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.23
4 0.25
5 0.28
6 0.29
7 0.28
8 0.3
9 0.3
10 0.29
11 0.24
12 0.2
13 0.16
14 0.15
15 0.14
16 0.12
17 0.1
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.09
25 0.09
26 0.11
27 0.12
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.13
34 0.12
35 0.12
36 0.11
37 0.13
38 0.11
39 0.1
40 0.11
41 0.1
42 0.09
43 0.08
44 0.08
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.14
54 0.24
55 0.31
56 0.32
57 0.4
58 0.47
59 0.55
60 0.65
61 0.69
62 0.69
63 0.72
64 0.81
65 0.83
66 0.84
67 0.77
68 0.68
69 0.59
70 0.54