Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409Y077

Protein Details
Accession A0A409Y077    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSDVRTRKKSTKDSPKKTQEVPKRKNHydrophilic
NLS Segment(s)
PositionSequence
8-19KKSTKDSPKKTQ
22-24PKR
Subcellular Location(s) mito 7, plas 6, mito_nucl 6, nucl 5, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSDVRTRKKSTKDSPKKTQEVPKRKNGGATAGDVDTVSSFSTTFIWLPVVLAVGVYLYLVRQLPGVSYRTVEVIYES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.86
4 0.83
5 0.82
6 0.82
7 0.82
8 0.79
9 0.78
10 0.75
11 0.69
12 0.67
13 0.58
14 0.53
15 0.43
16 0.38
17 0.3
18 0.23
19 0.22
20 0.17
21 0.16
22 0.09
23 0.08
24 0.06
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.02
45 0.04
46 0.05
47 0.05
48 0.06
49 0.06
50 0.08
51 0.12
52 0.14
53 0.13
54 0.14
55 0.15
56 0.16
57 0.16