Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WVB0

Protein Details
Accession A0A409WVB0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MSAKVKPAKRRPDKVGEGCRDVEPPRVCRTRRRGWVVPCSYHydrophilic
178-200YADYGTRVRRRRVRGRQELGAGRHydrophilic
NLS Segment(s)
PositionSequence
186-203RRRRVRGRQELGAGRAAR
Subcellular Location(s) cyto 10.5, cyto_nucl 10.5, nucl 9.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSAKVKPAKRRPDKVGEGCRDVEPPRVCRTRRRGWVVPCSYGHVDRRWMVLGDLGRYRCVCGGFGGLWMGVGRVVYRYHTPYSTSARGYDLGSSSRASCASSSALKSRRRTAKPSTTSVRLDADRRSYEREEAGGRRQREVWLEREVLNASWDGEVLLGGGLAPRAPATRQSNRIIVYADYGTRVRRRRVRGRQELGAGRAARGAAAAGRYLGAETRAIRRWGVESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.83
4 0.77
5 0.7
6 0.63
7 0.56
8 0.47
9 0.46
10 0.41
11 0.38
12 0.42
13 0.48
14 0.5
15 0.56
16 0.63
17 0.65
18 0.69
19 0.74
20 0.74
21 0.74
22 0.82
23 0.77
24 0.74
25 0.64
26 0.6
27 0.54
28 0.51
29 0.46
30 0.39
31 0.38
32 0.34
33 0.35
34 0.31
35 0.28
36 0.23
37 0.23
38 0.21
39 0.2
40 0.23
41 0.22
42 0.22
43 0.21
44 0.22
45 0.2
46 0.19
47 0.16
48 0.12
49 0.13
50 0.12
51 0.12
52 0.12
53 0.1
54 0.09
55 0.08
56 0.07
57 0.05
58 0.05
59 0.04
60 0.05
61 0.06
62 0.08
63 0.1
64 0.14
65 0.16
66 0.17
67 0.19
68 0.22
69 0.28
70 0.29
71 0.27
72 0.25
73 0.24
74 0.25
75 0.23
76 0.2
77 0.15
78 0.13
79 0.13
80 0.12
81 0.11
82 0.11
83 0.11
84 0.1
85 0.09
86 0.09
87 0.1
88 0.11
89 0.13
90 0.18
91 0.25
92 0.3
93 0.33
94 0.4
95 0.48
96 0.49
97 0.54
98 0.56
99 0.59
100 0.58
101 0.62
102 0.58
103 0.53
104 0.51
105 0.46
106 0.4
107 0.32
108 0.29
109 0.25
110 0.26
111 0.23
112 0.24
113 0.27
114 0.25
115 0.25
116 0.24
117 0.23
118 0.22
119 0.22
120 0.3
121 0.31
122 0.31
123 0.31
124 0.31
125 0.31
126 0.33
127 0.34
128 0.29
129 0.27
130 0.28
131 0.27
132 0.27
133 0.26
134 0.21
135 0.18
136 0.15
137 0.11
138 0.09
139 0.08
140 0.06
141 0.05
142 0.05
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.05
153 0.05
154 0.13
155 0.21
156 0.29
157 0.35
158 0.39
159 0.43
160 0.43
161 0.44
162 0.38
163 0.31
164 0.27
165 0.22
166 0.19
167 0.17
168 0.17
169 0.2
170 0.26
171 0.32
172 0.38
173 0.44
174 0.54
175 0.62
176 0.72
177 0.79
178 0.83
179 0.84
180 0.81
181 0.81
182 0.76
183 0.68
184 0.63
185 0.53
186 0.42
187 0.36
188 0.29
189 0.21
190 0.16
191 0.14
192 0.09
193 0.09
194 0.09
195 0.08
196 0.08
197 0.08
198 0.09
199 0.09
200 0.09
201 0.11
202 0.13
203 0.19
204 0.25
205 0.27
206 0.27
207 0.28