Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VF95

Protein Details
Accession A0A409VF95    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MYSKGRVLGHKRAKRNSRPNTSLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MYSKGRVLGHKRAKRNSRPNTSLIQIEGVATKEDAQFYLGKRVAFVYKAKREVQGSKVRVIWGRVTRPHGSSGVVKSKFQHNLPPRAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.87
4 0.86
5 0.82
6 0.77
7 0.72
8 0.64
9 0.55
10 0.45
11 0.36
12 0.25
13 0.21
14 0.18
15 0.14
16 0.11
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.09
23 0.11
24 0.11
25 0.19
26 0.2
27 0.19
28 0.19
29 0.2
30 0.19
31 0.19
32 0.23
33 0.24
34 0.27
35 0.31
36 0.32
37 0.34
38 0.35
39 0.36
40 0.39
41 0.4
42 0.37
43 0.35
44 0.35
45 0.35
46 0.33
47 0.32
48 0.31
49 0.27
50 0.3
51 0.32
52 0.36
53 0.37
54 0.37
55 0.38
56 0.32
57 0.29
58 0.28
59 0.3
60 0.34
61 0.33
62 0.32
63 0.32
64 0.39
65 0.42
66 0.39
67 0.44
68 0.43
69 0.51
70 0.52
71 0.55
72 0.49
73 0.47
74 0.45
75 0.36
76 0.34
77 0.27
78 0.27
79 0.23
80 0.22
81 0.19