Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409YTD3

Protein Details
Accession A0A409YTD3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
164-195ETCVDGQRKERKKGVKRGPYKRKVKNDGEGASBasic
NLS Segment(s)
PositionSequence
171-188RKERKKGVKRGPYKRKVK
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MTEAAAPSKAPSAPAPPPPPTQEQHAMPPAAIVPYAQQVNGVPYPPHMPYPPGAPNPYMPSIFAYPPPPPPDGSHPEGGVPPTQYMIGVPPGVLYYPPHPQAQGVYFVSFAYGPPPASSPAPPPALTRPKRKQVKMACTNCANACKRCDESRPCERCVKYGISETCVDGQRKERKKGVKRGPYKRKVKNDGEGASYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.41
4 0.45
5 0.48
6 0.52
7 0.47
8 0.49
9 0.47
10 0.44
11 0.47
12 0.47
13 0.43
14 0.37
15 0.35
16 0.29
17 0.22
18 0.19
19 0.12
20 0.08
21 0.11
22 0.12
23 0.11
24 0.11
25 0.11
26 0.16
27 0.17
28 0.17
29 0.13
30 0.14
31 0.18
32 0.18
33 0.2
34 0.17
35 0.17
36 0.17
37 0.23
38 0.28
39 0.28
40 0.29
41 0.28
42 0.3
43 0.32
44 0.34
45 0.28
46 0.22
47 0.21
48 0.21
49 0.21
50 0.2
51 0.18
52 0.18
53 0.22
54 0.25
55 0.23
56 0.22
57 0.24
58 0.29
59 0.32
60 0.34
61 0.31
62 0.28
63 0.27
64 0.26
65 0.25
66 0.19
67 0.14
68 0.1
69 0.09
70 0.09
71 0.08
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.11
84 0.13
85 0.13
86 0.13
87 0.13
88 0.15
89 0.15
90 0.17
91 0.14
92 0.12
93 0.12
94 0.12
95 0.12
96 0.1
97 0.09
98 0.06
99 0.06
100 0.06
101 0.06
102 0.08
103 0.09
104 0.1
105 0.12
106 0.13
107 0.17
108 0.19
109 0.19
110 0.21
111 0.27
112 0.36
113 0.41
114 0.48
115 0.51
116 0.59
117 0.68
118 0.69
119 0.7
120 0.7
121 0.75
122 0.76
123 0.73
124 0.69
125 0.63
126 0.63
127 0.56
128 0.54
129 0.48
130 0.41
131 0.38
132 0.36
133 0.38
134 0.39
135 0.45
136 0.46
137 0.49
138 0.56
139 0.59
140 0.58
141 0.63
142 0.59
143 0.54
144 0.51
145 0.48
146 0.4
147 0.44
148 0.42
149 0.37
150 0.37
151 0.35
152 0.36
153 0.36
154 0.34
155 0.28
156 0.35
157 0.42
158 0.49
159 0.55
160 0.58
161 0.63
162 0.72
163 0.8
164 0.82
165 0.82
166 0.85
167 0.89
168 0.92
169 0.92
170 0.92
171 0.92
172 0.92
173 0.91
174 0.89
175 0.87
176 0.85
177 0.78