Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WAX0

Protein Details
Accession A0A409WAX0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
499-519LSNNHKTHQRHLQNQFERHQHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, nucl 6.5, cyto_nucl 5, mito 3, cyto 2.5, plas 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010740  Endomucin  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07010  Endomucin  
Amino Acid Sequences MSVQKVAVDDTDPSVVYSGQWSVQRSASAYGNSLHVSTSAGASASLSFTGISVNILGTIPPCTVTGSPVTYQVVLDASPVDWGTAACTTSTQNNVLFYSSTQLSNGPHKVTIIDEANESPMLMLDLFAYVTSSEGGGGAAGTSAVGGAAGTTLSASVLSHPTTSSQDAGMTSSATSAQQSSTPSNSASTTSTSSGKTSSGDQATSSAQSSASDSLPTPTNSQPSSNNSNNSSLSQSSTTSHSHSTGPIIGGVVAAVLVLTLLVLFLFYHLRKRKGRQPSYTSKIVMPFNLNLNLRRGGADPESPLGASGGESHQNSTSELIERGRSTTVRALSDSGNNHNHNNNNRPLERSMPNNIVPFILDGVAVGAGRQQAELVVPGSARPSSVLDPEYASGLGGPPSAASEKARLVAGDGGASASGGAASSSSPSSAAAHVTPSWHPDEKRRSGPRSPAANPGPHLSATPSDAAPAYMLDPDPGPIPSPPIAQSDAHAESNTHSPLSNNHKTHQRHLQNQFERHQHYPSGLSASSDLLSGIGTGTGMSSEVPPAYNDCCAYPGPHHHHHDHQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.13
5 0.13
6 0.15
7 0.19
8 0.21
9 0.23
10 0.26
11 0.27
12 0.26
13 0.28
14 0.28
15 0.26
16 0.25
17 0.23
18 0.23
19 0.23
20 0.21
21 0.17
22 0.14
23 0.14
24 0.13
25 0.12
26 0.1
27 0.09
28 0.09
29 0.09
30 0.1
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.08
37 0.07
38 0.07
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.09
46 0.09
47 0.09
48 0.1
49 0.11
50 0.12
51 0.14
52 0.17
53 0.19
54 0.19
55 0.22
56 0.23
57 0.2
58 0.2
59 0.18
60 0.16
61 0.12
62 0.12
63 0.09
64 0.08
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.09
71 0.09
72 0.1
73 0.08
74 0.1
75 0.11
76 0.15
77 0.18
78 0.19
79 0.19
80 0.2
81 0.21
82 0.21
83 0.2
84 0.17
85 0.18
86 0.17
87 0.16
88 0.15
89 0.16
90 0.18
91 0.24
92 0.28
93 0.25
94 0.24
95 0.24
96 0.24
97 0.23
98 0.26
99 0.21
100 0.19
101 0.18
102 0.18
103 0.19
104 0.19
105 0.17
106 0.12
107 0.09
108 0.08
109 0.07
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.03
143 0.05
144 0.07
145 0.08
146 0.09
147 0.09
148 0.11
149 0.14
150 0.15
151 0.14
152 0.13
153 0.13
154 0.13
155 0.14
156 0.12
157 0.1
158 0.08
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.07
165 0.09
166 0.12
167 0.14
168 0.15
169 0.16
170 0.16
171 0.17
172 0.17
173 0.16
174 0.15
175 0.15
176 0.15
177 0.16
178 0.18
179 0.17
180 0.17
181 0.17
182 0.16
183 0.15
184 0.15
185 0.18
186 0.17
187 0.17
188 0.16
189 0.17
190 0.18
191 0.18
192 0.16
193 0.11
194 0.09
195 0.09
196 0.11
197 0.11
198 0.1
199 0.1
200 0.09
201 0.11
202 0.13
203 0.14
204 0.16
205 0.16
206 0.2
207 0.2
208 0.22
209 0.24
210 0.27
211 0.33
212 0.34
213 0.35
214 0.33
215 0.35
216 0.34
217 0.32
218 0.29
219 0.22
220 0.2
221 0.17
222 0.16
223 0.14
224 0.17
225 0.17
226 0.16
227 0.17
228 0.17
229 0.16
230 0.16
231 0.16
232 0.14
233 0.13
234 0.11
235 0.1
236 0.08
237 0.07
238 0.06
239 0.04
240 0.03
241 0.02
242 0.02
243 0.02
244 0.01
245 0.01
246 0.01
247 0.01
248 0.01
249 0.01
250 0.02
251 0.02
252 0.03
253 0.05
254 0.06
255 0.14
256 0.18
257 0.25
258 0.29
259 0.35
260 0.43
261 0.52
262 0.6
263 0.61
264 0.65
265 0.68
266 0.69
267 0.68
268 0.61
269 0.51
270 0.47
271 0.39
272 0.33
273 0.25
274 0.21
275 0.19
276 0.22
277 0.21
278 0.18
279 0.2
280 0.2
281 0.18
282 0.18
283 0.16
284 0.14
285 0.15
286 0.15
287 0.13
288 0.12
289 0.12
290 0.11
291 0.1
292 0.08
293 0.06
294 0.05
295 0.05
296 0.06
297 0.09
298 0.09
299 0.1
300 0.11
301 0.12
302 0.12
303 0.12
304 0.12
305 0.1
306 0.11
307 0.12
308 0.12
309 0.12
310 0.13
311 0.13
312 0.13
313 0.13
314 0.17
315 0.18
316 0.18
317 0.18
318 0.18
319 0.18
320 0.22
321 0.22
322 0.23
323 0.26
324 0.27
325 0.28
326 0.3
327 0.34
328 0.36
329 0.4
330 0.41
331 0.41
332 0.41
333 0.42
334 0.4
335 0.41
336 0.38
337 0.36
338 0.34
339 0.33
340 0.35
341 0.32
342 0.31
343 0.25
344 0.22
345 0.18
346 0.14
347 0.1
348 0.07
349 0.05
350 0.05
351 0.05
352 0.05
353 0.04
354 0.05
355 0.05
356 0.05
357 0.05
358 0.05
359 0.05
360 0.06
361 0.07
362 0.06
363 0.06
364 0.06
365 0.06
366 0.07
367 0.07
368 0.07
369 0.07
370 0.09
371 0.1
372 0.13
373 0.14
374 0.13
375 0.14
376 0.14
377 0.14
378 0.12
379 0.1
380 0.08
381 0.07
382 0.07
383 0.06
384 0.05
385 0.04
386 0.06
387 0.07
388 0.08
389 0.09
390 0.11
391 0.12
392 0.13
393 0.14
394 0.12
395 0.13
396 0.14
397 0.13
398 0.1
399 0.09
400 0.08
401 0.07
402 0.07
403 0.05
404 0.03
405 0.03
406 0.03
407 0.03
408 0.03
409 0.03
410 0.04
411 0.05
412 0.05
413 0.06
414 0.06
415 0.08
416 0.09
417 0.1
418 0.09
419 0.12
420 0.12
421 0.14
422 0.15
423 0.16
424 0.21
425 0.24
426 0.25
427 0.32
428 0.42
429 0.47
430 0.56
431 0.62
432 0.63
433 0.66
434 0.74
435 0.73
436 0.72
437 0.68
438 0.67
439 0.63
440 0.61
441 0.56
442 0.49
443 0.42
444 0.34
445 0.32
446 0.24
447 0.21
448 0.19
449 0.19
450 0.16
451 0.14
452 0.14
453 0.14
454 0.12
455 0.11
456 0.09
457 0.09
458 0.09
459 0.09
460 0.09
461 0.09
462 0.1
463 0.1
464 0.11
465 0.1
466 0.14
467 0.15
468 0.17
469 0.18
470 0.2
471 0.23
472 0.21
473 0.22
474 0.25
475 0.27
476 0.26
477 0.24
478 0.21
479 0.2
480 0.25
481 0.25
482 0.19
483 0.16
484 0.16
485 0.23
486 0.32
487 0.4
488 0.38
489 0.42
490 0.51
491 0.55
492 0.62
493 0.66
494 0.66
495 0.66
496 0.72
497 0.78
498 0.78
499 0.81
500 0.8
501 0.78
502 0.74
503 0.67
504 0.62
505 0.53
506 0.46
507 0.42
508 0.37
509 0.34
510 0.28
511 0.26
512 0.23
513 0.23
514 0.2
515 0.17
516 0.15
517 0.09
518 0.09
519 0.07
520 0.07
521 0.05
522 0.04
523 0.04
524 0.04
525 0.04
526 0.05
527 0.05
528 0.06
529 0.08
530 0.09
531 0.1
532 0.11
533 0.14
534 0.16
535 0.18
536 0.19
537 0.18
538 0.2
539 0.2
540 0.22
541 0.26
542 0.34
543 0.38
544 0.47
545 0.53
546 0.56