Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7XAR5

Protein Details
Accession G7XAR5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPPRRKKPLSLRIRQWIHRLRTHydrophilic
NLS Segment(s)
PositionSequence
6-8RKK
Subcellular Location(s) mito 9, plas 7, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MPPPRRKKPLSLRIRQWIHRLRTWRSPLNLRGSLTRLRAFERHPVWALVRLFIPFPSWKFPVSDVMPAAEMIGNEELLLLRHDNMIDLESIPIWRVRDTPLRCLYRMYEAMASGVYEVLGTETEYFWYQKGWSLQSISDPRDEDPVRYAIIACLVEELVVAFNWRLSLGMRRNRKHIIRKTEDDPWPPYTPLIGPAWTGSVPALSASDLDGLPGRYILEGKLVLEDGGLNKIFARRNIITNVGWLYTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.82
3 0.81
4 0.8
5 0.76
6 0.72
7 0.71
8 0.66
9 0.69
10 0.71
11 0.69
12 0.66
13 0.68
14 0.68
15 0.7
16 0.68
17 0.6
18 0.55
19 0.52
20 0.5
21 0.47
22 0.44
23 0.36
24 0.36
25 0.38
26 0.37
27 0.42
28 0.39
29 0.39
30 0.37
31 0.38
32 0.35
33 0.38
34 0.36
35 0.28
36 0.26
37 0.22
38 0.2
39 0.18
40 0.19
41 0.15
42 0.17
43 0.21
44 0.22
45 0.22
46 0.23
47 0.24
48 0.28
49 0.27
50 0.28
51 0.23
52 0.22
53 0.21
54 0.2
55 0.19
56 0.13
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.07
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.07
74 0.07
75 0.07
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.12
84 0.21
85 0.23
86 0.3
87 0.37
88 0.39
89 0.39
90 0.4
91 0.37
92 0.34
93 0.33
94 0.27
95 0.19
96 0.16
97 0.16
98 0.15
99 0.13
100 0.08
101 0.06
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.04
110 0.05
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.09
117 0.12
118 0.12
119 0.13
120 0.14
121 0.14
122 0.19
123 0.23
124 0.21
125 0.21
126 0.21
127 0.2
128 0.25
129 0.25
130 0.2
131 0.19
132 0.19
133 0.17
134 0.16
135 0.16
136 0.09
137 0.11
138 0.1
139 0.08
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.13
155 0.21
156 0.29
157 0.38
158 0.41
159 0.47
160 0.55
161 0.62
162 0.65
163 0.66
164 0.69
165 0.68
166 0.71
167 0.7
168 0.71
169 0.68
170 0.63
171 0.58
172 0.52
173 0.47
174 0.42
175 0.38
176 0.3
177 0.25
178 0.23
179 0.21
180 0.16
181 0.14
182 0.13
183 0.15
184 0.14
185 0.13
186 0.1
187 0.08
188 0.07
189 0.07
190 0.07
191 0.06
192 0.06
193 0.06
194 0.08
195 0.07
196 0.08
197 0.1
198 0.1
199 0.1
200 0.1
201 0.1
202 0.09
203 0.1
204 0.09
205 0.11
206 0.11
207 0.11
208 0.12
209 0.12
210 0.11
211 0.11
212 0.12
213 0.09
214 0.13
215 0.13
216 0.11
217 0.12
218 0.18
219 0.21
220 0.22
221 0.29
222 0.28
223 0.32
224 0.37
225 0.4
226 0.36
227 0.36
228 0.36