Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LIS2

Protein Details
Accession E2LIS2   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-89HRGISGKQEKERKRRGRRKLEDGEESBasic
NLS Segment(s)
PositionSequence
46-83KESERKREDKRIMQVKGDHRGISGKQEKERKRRGRRKL
Subcellular Location(s) cyto_nucl 11.833, nucl 11.5, cyto 10, mito_nucl 9.166, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR014816  tRNA_MeTrfase_Gcd14  
Gene Ontology GO:0031515  C:tRNA (m1A) methyltransferase complex  
GO:0016429  F:tRNA (adenine-N1-)-methyltransferase activity  
KEGG mpr:MPER_06468  -  
Pfam View protein in Pfam  
PF08704  GCD14  
PROSITE View protein in PROSITE  
PS51620  SAM_TRM61  
Amino Acid Sequences QVLRTVTALNAEGFFEITTYETLLRPYELSPSSSLPTIFDAANKIKESERKREDKRIMQVKGDHRGISGKQEKERKRRGRRKLEDGEESDSKRAKTKVEGMEETEPVIVSEPSAAEYQARPTPRGKVVEGGKVLARVMPEVRGHTSYLTFAVLLPALPGEEQETANGELVEQIEGQVEAEDVQMKEAQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.07
4 0.08
5 0.07
6 0.08
7 0.09
8 0.09
9 0.11
10 0.12
11 0.13
12 0.13
13 0.13
14 0.17
15 0.17
16 0.19
17 0.2
18 0.22
19 0.22
20 0.22
21 0.22
22 0.17
23 0.18
24 0.17
25 0.15
26 0.14
27 0.16
28 0.18
29 0.22
30 0.22
31 0.21
32 0.23
33 0.31
34 0.36
35 0.42
36 0.47
37 0.53
38 0.58
39 0.67
40 0.72
41 0.72
42 0.76
43 0.75
44 0.7
45 0.65
46 0.65
47 0.61
48 0.61
49 0.55
50 0.45
51 0.36
52 0.36
53 0.32
54 0.34
55 0.36
56 0.32
57 0.36
58 0.45
59 0.53
60 0.59
61 0.7
62 0.71
63 0.75
64 0.81
65 0.86
66 0.88
67 0.88
68 0.88
69 0.87
70 0.82
71 0.76
72 0.69
73 0.64
74 0.55
75 0.48
76 0.4
77 0.32
78 0.27
79 0.24
80 0.22
81 0.18
82 0.18
83 0.25
84 0.29
85 0.32
86 0.33
87 0.32
88 0.34
89 0.32
90 0.3
91 0.22
92 0.16
93 0.11
94 0.11
95 0.07
96 0.04
97 0.05
98 0.04
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.1
105 0.14
106 0.15
107 0.16
108 0.17
109 0.22
110 0.26
111 0.29
112 0.27
113 0.3
114 0.32
115 0.36
116 0.35
117 0.31
118 0.27
119 0.24
120 0.23
121 0.18
122 0.15
123 0.1
124 0.1
125 0.12
126 0.13
127 0.15
128 0.18
129 0.19
130 0.19
131 0.19
132 0.19
133 0.16
134 0.16
135 0.14
136 0.11
137 0.09
138 0.09
139 0.08
140 0.07
141 0.07
142 0.06
143 0.06
144 0.05
145 0.06
146 0.07
147 0.09
148 0.09
149 0.09
150 0.12
151 0.13
152 0.14
153 0.14
154 0.11
155 0.11
156 0.11
157 0.12
158 0.09
159 0.08
160 0.08
161 0.08
162 0.08
163 0.07
164 0.06
165 0.06
166 0.07
167 0.11
168 0.1
169 0.12