Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WCC2

Protein Details
Accession A0A409WCC2    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-100MYRFLRYEEKKKRGRNRKRRKVKRVTNDYQQRPNKBasic
NLS Segment(s)
PositionSequence
74-91EKKKRGRNRKRRKVKRVT
97-108RPNKEAGRGRRA
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIRPGIEERNRGSHQGIPPTPKVERQGDEPDHALAPNFKDGKSETTTSKLHEEKAKRVVFHRPGNMYRFLRYEEKKKRGRNRKRRKVKRVTNDYQQRPNKEAGRGRRAERALQKTSVVQRARTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.47
4 0.44
5 0.45
6 0.48
7 0.47
8 0.45
9 0.45
10 0.41
11 0.39
12 0.39
13 0.45
14 0.43
15 0.44
16 0.41
17 0.37
18 0.31
19 0.29
20 0.24
21 0.16
22 0.15
23 0.18
24 0.18
25 0.17
26 0.18
27 0.19
28 0.23
29 0.25
30 0.26
31 0.21
32 0.25
33 0.26
34 0.26
35 0.31
36 0.28
37 0.27
38 0.32
39 0.33
40 0.34
41 0.42
42 0.42
43 0.37
44 0.38
45 0.43
46 0.44
47 0.46
48 0.45
49 0.4
50 0.41
51 0.43
52 0.48
53 0.4
54 0.34
55 0.3
56 0.29
57 0.32
58 0.32
59 0.4
60 0.43
61 0.51
62 0.58
63 0.66
64 0.73
65 0.77
66 0.85
67 0.86
68 0.88
69 0.9
70 0.93
71 0.95
72 0.96
73 0.96
74 0.95
75 0.95
76 0.94
77 0.9
78 0.89
79 0.88
80 0.84
81 0.83
82 0.8
83 0.74
84 0.66
85 0.66
86 0.6
87 0.58
88 0.59
89 0.58
90 0.61
91 0.61
92 0.61
93 0.63
94 0.61
95 0.61
96 0.63
97 0.62
98 0.57
99 0.54
100 0.53
101 0.51
102 0.55
103 0.55
104 0.49
105 0.44