Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409YAT8

Protein Details
Accession A0A409YAT8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-79LYKIKFLQNRYKLKRRKYRAQSLSPLKKLHydrophilic
NLS Segment(s)
PositionSequence
65-65R
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MDQSARELCRLMQREEVPQILVKVFAVKFWHKLTCSRRKCFASRARASQALYKIKFLQNRYKLKRRKYRAQSLSPLKKLEYARPFSMGGQFLPSGLDEDSLEGSTAAELELTSVDLDEDVDSSSASSCPRIGSNGRISPIPLAVRFSLWHQDSLALPSGSTARANNSAPTSNSRNRPYYAFRKRRYLPALRPQCSSSRDLGPSNSTIRGQRRGPRSEPDGWEADIEDNSPLYLGSSGETELAEGYASDGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.45
4 0.37
5 0.35
6 0.33
7 0.26
8 0.23
9 0.17
10 0.19
11 0.17
12 0.18
13 0.22
14 0.23
15 0.27
16 0.31
17 0.36
18 0.32
19 0.41
20 0.48
21 0.54
22 0.6
23 0.62
24 0.67
25 0.68
26 0.72
27 0.73
28 0.73
29 0.73
30 0.71
31 0.72
32 0.7
33 0.67
34 0.64
35 0.6
36 0.58
37 0.56
38 0.5
39 0.45
40 0.43
41 0.45
42 0.48
43 0.47
44 0.5
45 0.5
46 0.6
47 0.66
48 0.71
49 0.74
50 0.8
51 0.85
52 0.83
53 0.85
54 0.84
55 0.86
56 0.85
57 0.86
58 0.85
59 0.85
60 0.86
61 0.79
62 0.7
63 0.59
64 0.56
65 0.49
66 0.48
67 0.45
68 0.41
69 0.39
70 0.4
71 0.4
72 0.35
73 0.36
74 0.29
75 0.21
76 0.17
77 0.16
78 0.13
79 0.13
80 0.12
81 0.09
82 0.08
83 0.08
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.03
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.09
118 0.1
119 0.15
120 0.21
121 0.23
122 0.23
123 0.23
124 0.23
125 0.21
126 0.21
127 0.18
128 0.12
129 0.12
130 0.11
131 0.11
132 0.12
133 0.13
134 0.17
135 0.17
136 0.17
137 0.15
138 0.16
139 0.16
140 0.18
141 0.19
142 0.12
143 0.11
144 0.11
145 0.12
146 0.11
147 0.12
148 0.1
149 0.09
150 0.13
151 0.14
152 0.16
153 0.17
154 0.19
155 0.19
156 0.24
157 0.29
158 0.32
159 0.38
160 0.41
161 0.42
162 0.42
163 0.45
164 0.48
165 0.52
166 0.57
167 0.6
168 0.6
169 0.66
170 0.67
171 0.72
172 0.72
173 0.71
174 0.69
175 0.7
176 0.76
177 0.69
178 0.68
179 0.61
180 0.59
181 0.53
182 0.47
183 0.4
184 0.35
185 0.37
186 0.36
187 0.36
188 0.33
189 0.33
190 0.32
191 0.31
192 0.27
193 0.3
194 0.33
195 0.38
196 0.41
197 0.46
198 0.51
199 0.56
200 0.59
201 0.6
202 0.61
203 0.62
204 0.6
205 0.56
206 0.51
207 0.44
208 0.4
209 0.34
210 0.29
211 0.21
212 0.18
213 0.13
214 0.11
215 0.1
216 0.09
217 0.08
218 0.07
219 0.07
220 0.07
221 0.07
222 0.08
223 0.08
224 0.09
225 0.09
226 0.08
227 0.08
228 0.08
229 0.07
230 0.06