Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YCN9

Protein Details
Accession A0A409YCN9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-83NIKPSSTSSRSKKSKSKNSKRHydrophilic
NLS Segment(s)
PositionSequence
72-83RSKKSKSKNSKR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MTSVEESTTSNPPSRNPIVARHRVKGDVYRFHFKEPGPEYEILSQEEANLAFPPWEPTADIWNIKPSSTSSRSKKSKSKNSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.34
4 0.41
5 0.47
6 0.56
7 0.59
8 0.55
9 0.54
10 0.51
11 0.51
12 0.49
13 0.46
14 0.45
15 0.46
16 0.5
17 0.49
18 0.48
19 0.49
20 0.42
21 0.43
22 0.38
23 0.36
24 0.31
25 0.3
26 0.3
27 0.29
28 0.3
29 0.22
30 0.19
31 0.14
32 0.11
33 0.11
34 0.09
35 0.07
36 0.06
37 0.06
38 0.05
39 0.06
40 0.09
41 0.09
42 0.1
43 0.1
44 0.11
45 0.15
46 0.18
47 0.19
48 0.17
49 0.23
50 0.23
51 0.22
52 0.23
53 0.22
54 0.27
55 0.31
56 0.4
57 0.4
58 0.51
59 0.59
60 0.67
61 0.73
62 0.76
63 0.81