Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WR49

Protein Details
Accession A0A409WR49    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
143-164SSAYIYKAKHWTRRASRISRRSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6, extr 6, plas 5, E.R. 4, golg 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045888  Erv  
IPR039542  Erv_N  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13850  ERGIC_N  
Amino Acid Sequences MASTPTSHTNGSGEPSLLDKLDAVAPLAKLDAFPKVPSTYKTRSESRGFMTLFVAFLAFLLILNDVGEFIWGWPDYEFSVDGSKSNYLNINLDMVVAMPCGFLSVDLRDAMGDRLYLSGGLRRDGPSFPWDSVPFSFHARLVSSAYIYKAKHWTRRASRISRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.16
5 0.15
6 0.11
7 0.11
8 0.12
9 0.12
10 0.11
11 0.11
12 0.11
13 0.11
14 0.12
15 0.1
16 0.09
17 0.1
18 0.13
19 0.12
20 0.13
21 0.16
22 0.18
23 0.21
24 0.23
25 0.3
26 0.31
27 0.38
28 0.42
29 0.44
30 0.47
31 0.49
32 0.5
33 0.47
34 0.47
35 0.4
36 0.36
37 0.32
38 0.26
39 0.22
40 0.18
41 0.14
42 0.06
43 0.06
44 0.05
45 0.04
46 0.03
47 0.03
48 0.04
49 0.03
50 0.04
51 0.04
52 0.03
53 0.03
54 0.04
55 0.03
56 0.03
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.06
66 0.08
67 0.08
68 0.08
69 0.09
70 0.1
71 0.09
72 0.1
73 0.11
74 0.1
75 0.11
76 0.11
77 0.11
78 0.09
79 0.09
80 0.08
81 0.07
82 0.06
83 0.05
84 0.04
85 0.03
86 0.03
87 0.04
88 0.04
89 0.03
90 0.05
91 0.06
92 0.07
93 0.07
94 0.08
95 0.07
96 0.08
97 0.09
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.07
104 0.06
105 0.1
106 0.1
107 0.11
108 0.13
109 0.14
110 0.16
111 0.17
112 0.19
113 0.19
114 0.21
115 0.22
116 0.24
117 0.24
118 0.25
119 0.26
120 0.25
121 0.23
122 0.24
123 0.24
124 0.21
125 0.22
126 0.19
127 0.2
128 0.21
129 0.2
130 0.18
131 0.18
132 0.2
133 0.23
134 0.22
135 0.25
136 0.32
137 0.38
138 0.46
139 0.52
140 0.6
141 0.65
142 0.75
143 0.8
144 0.81