Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VIH7

Protein Details
Accession A0A409VIH7    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGPGRPKAKGKPKRRKNVYYAMHADBasic
NLS Segment(s)
PositionSequence
4-41GRPKAKGKPKRRKNVYYAMHADKERPKALIRARKRKAR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MGPGRPKAKGKPKRRKNVYYAMHADKERPKALIRARKRKARLTPEELQVEREMHRLAQARYRERNRELLRQKALEYREKMLRQRGHDDKAPVFDSDASNFDDTPEPESSDRKTSRAIDIVEASLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.89
4 0.89
5 0.84
6 0.82
7 0.79
8 0.74
9 0.69
10 0.6
11 0.57
12 0.52
13 0.52
14 0.44
15 0.38
16 0.34
17 0.36
18 0.44
19 0.49
20 0.53
21 0.59
22 0.65
23 0.72
24 0.76
25 0.78
26 0.78
27 0.78
28 0.77
29 0.73
30 0.72
31 0.69
32 0.69
33 0.6
34 0.52
35 0.43
36 0.36
37 0.28
38 0.24
39 0.18
40 0.12
41 0.15
42 0.17
43 0.16
44 0.21
45 0.26
46 0.3
47 0.38
48 0.43
49 0.45
50 0.44
51 0.52
52 0.5
53 0.54
54 0.54
55 0.53
56 0.52
57 0.48
58 0.47
59 0.43
60 0.43
61 0.4
62 0.37
63 0.34
64 0.37
65 0.39
66 0.42
67 0.45
68 0.47
69 0.44
70 0.5
71 0.52
72 0.5
73 0.51
74 0.51
75 0.45
76 0.44
77 0.41
78 0.32
79 0.27
80 0.24
81 0.22
82 0.19
83 0.19
84 0.17
85 0.16
86 0.16
87 0.16
88 0.18
89 0.17
90 0.19
91 0.19
92 0.2
93 0.2
94 0.24
95 0.26
96 0.31
97 0.33
98 0.31
99 0.35
100 0.35
101 0.4
102 0.43
103 0.41
104 0.36
105 0.37