Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I6NCM2

Protein Details
Accession I6NCM2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-54NSSDTPEKKRNYKEYRRKCIIWHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 5, golg 3, mito 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024359  Peroxin-22  
IPR038613  Peroxin-22_C_sf  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
KEGG erc:Ecym_5011  -  
Pfam View protein in Pfam  
PF12827  Peroxin-22  
Amino Acid Sequences MVAERRTSRILKPLVAVAGFALAAGVIVYSYWNSSDTPEKKRNYKEYRRKCIIWSPAVEQSSNLETILLEDSVILIPPESGSLQDLLAVGNENAYKIIKCDTWQGVWSCVRHLRAHYLLLKECEIPEAIPVDILNYVNKIISI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.28
4 0.19
5 0.16
6 0.13
7 0.1
8 0.07
9 0.04
10 0.03
11 0.03
12 0.03
13 0.02
14 0.02
15 0.03
16 0.03
17 0.04
18 0.05
19 0.06
20 0.07
21 0.09
22 0.19
23 0.24
24 0.32
25 0.4
26 0.44
27 0.51
28 0.59
29 0.67
30 0.69
31 0.75
32 0.77
33 0.8
34 0.86
35 0.85
36 0.78
37 0.72
38 0.7
39 0.66
40 0.6
41 0.52
42 0.45
43 0.44
44 0.43
45 0.38
46 0.3
47 0.25
48 0.21
49 0.18
50 0.14
51 0.08
52 0.07
53 0.08
54 0.09
55 0.06
56 0.05
57 0.04
58 0.05
59 0.05
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.05
77 0.06
78 0.06
79 0.05
80 0.06
81 0.07
82 0.06
83 0.07
84 0.09
85 0.09
86 0.1
87 0.16
88 0.18
89 0.19
90 0.23
91 0.24
92 0.26
93 0.29
94 0.29
95 0.27
96 0.29
97 0.31
98 0.3
99 0.31
100 0.33
101 0.32
102 0.37
103 0.38
104 0.38
105 0.39
106 0.39
107 0.38
108 0.32
109 0.3
110 0.25
111 0.21
112 0.17
113 0.15
114 0.14
115 0.12
116 0.11
117 0.11
118 0.11
119 0.11
120 0.12
121 0.11
122 0.11
123 0.11