Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VJ94

Protein Details
Accession A0A409VJ94    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-102VKRTLGIRSTPRRQRRLVKSSRYHydrophilic
NLS Segment(s)
PositionSequence
91-92RR
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MPLFGSRTTRHHHHTTPMGTRSSRSRYGFFHRKDRDRVAGGYKAALSNPNTSHAGRKHAKRELRLMGRGNETHVPFMTKVKRTLGIRSTPRRQRRLVKSSRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.6
4 0.58
5 0.55
6 0.49
7 0.48
8 0.47
9 0.45
10 0.46
11 0.41
12 0.4
13 0.41
14 0.5
15 0.57
16 0.55
17 0.59
18 0.6
19 0.63
20 0.67
21 0.67
22 0.63
23 0.56
24 0.54
25 0.48
26 0.43
27 0.36
28 0.3
29 0.25
30 0.2
31 0.17
32 0.18
33 0.14
34 0.14
35 0.15
36 0.17
37 0.18
38 0.18
39 0.23
40 0.22
41 0.28
42 0.3
43 0.35
44 0.39
45 0.44
46 0.49
47 0.48
48 0.53
49 0.54
50 0.55
51 0.55
52 0.51
53 0.48
54 0.47
55 0.44
56 0.4
57 0.36
58 0.31
59 0.27
60 0.24
61 0.23
62 0.19
63 0.26
64 0.3
65 0.29
66 0.31
67 0.33
68 0.39
69 0.39
70 0.46
71 0.45
72 0.48
73 0.54
74 0.6
75 0.67
76 0.71
77 0.78
78 0.78
79 0.8
80 0.81
81 0.82
82 0.83