Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WQU9

Protein Details
Accession A0A409WQU9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-48YYRNLDKERARSRRRAQKSRETRGALHydrophilic
NLS Segment(s)
PositionSequence
29-87KERARSRRRAQKSRETRGALPPDVLEFRKKLHREAQARYREKHRLKLRTEAWEYRLKKK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MPVVVKSQSELLDDLRARKREWYYRNLDKERARSRRRAQKSRETRGALPPDVLEFRKKLHREAQARYREKHRLKLRTEAWEYRLKKKNARSLAEDEEEYQRLMSLPSDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.35
4 0.34
5 0.4
6 0.46
7 0.48
8 0.53
9 0.55
10 0.57
11 0.64
12 0.73
13 0.71
14 0.72
15 0.68
16 0.71
17 0.73
18 0.74
19 0.7
20 0.69
21 0.74
22 0.77
23 0.82
24 0.82
25 0.79
26 0.8
27 0.85
28 0.84
29 0.83
30 0.76
31 0.69
32 0.67
33 0.64
34 0.53
35 0.43
36 0.34
37 0.27
38 0.24
39 0.22
40 0.16
41 0.12
42 0.13
43 0.2
44 0.21
45 0.24
46 0.29
47 0.37
48 0.41
49 0.48
50 0.55
51 0.58
52 0.62
53 0.61
54 0.6
55 0.62
56 0.6
57 0.63
58 0.62
59 0.61
60 0.6
61 0.66
62 0.65
63 0.64
64 0.66
65 0.61
66 0.56
67 0.57
68 0.57
69 0.57
70 0.61
71 0.56
72 0.57
73 0.62
74 0.67
75 0.67
76 0.69
77 0.65
78 0.63
79 0.65
80 0.61
81 0.54
82 0.47
83 0.42
84 0.38
85 0.31
86 0.24
87 0.18
88 0.15
89 0.14