Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WYU5

Protein Details
Accession A0A409WYU5    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MVAKKNDGKTRQRRYWERNREKINAANARRNRERRMRRKLNSQPSAQSHydrophilic
191-214RIAVSRQKVKAQAKRKAREELPKAHydrophilic
NLS Segment(s)
PositionSequence
8-39GKTRQRRYWERNREKINAANARRNRERRMRRK
200-208KAQAKRKAR
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MVAKKNDGKTRQRRYWERNREKINAANARRNRERRMRRKLNSQPSAQSQPQESFQPTVVESDTSSHSPSNILTTIEKCAPDPTLLEDVATYKGRFKNYQEEVGLAIDEYQKGSDFARGWTSKVSFIANGLSKKILKLEKEGLSMIREGSVLLKRLSYRIDTHLQEWEETSTAYMHTGGYLRVMNYIDDTYRIAVSRQKVKAQAKRKAREELPKASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.9
5 0.89
6 0.88
7 0.83
8 0.78
9 0.75
10 0.74
11 0.72
12 0.67
13 0.67
14 0.65
15 0.68
16 0.72
17 0.72
18 0.71
19 0.72
20 0.77
21 0.78
22 0.84
23 0.86
24 0.83
25 0.88
26 0.9
27 0.9
28 0.86
29 0.8
30 0.75
31 0.71
32 0.71
33 0.62
34 0.54
35 0.46
36 0.41
37 0.38
38 0.35
39 0.3
40 0.25
41 0.24
42 0.22
43 0.19
44 0.19
45 0.17
46 0.14
47 0.12
48 0.13
49 0.14
50 0.13
51 0.14
52 0.13
53 0.12
54 0.12
55 0.12
56 0.13
57 0.12
58 0.12
59 0.12
60 0.13
61 0.16
62 0.18
63 0.18
64 0.15
65 0.15
66 0.15
67 0.14
68 0.13
69 0.14
70 0.14
71 0.14
72 0.13
73 0.12
74 0.12
75 0.14
76 0.15
77 0.12
78 0.14
79 0.17
80 0.2
81 0.22
82 0.24
83 0.31
84 0.32
85 0.37
86 0.32
87 0.3
88 0.28
89 0.26
90 0.23
91 0.13
92 0.1
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.08
101 0.08
102 0.09
103 0.15
104 0.16
105 0.16
106 0.18
107 0.19
108 0.17
109 0.18
110 0.17
111 0.11
112 0.11
113 0.15
114 0.16
115 0.15
116 0.15
117 0.16
118 0.16
119 0.16
120 0.2
121 0.2
122 0.18
123 0.22
124 0.28
125 0.29
126 0.31
127 0.31
128 0.27
129 0.25
130 0.24
131 0.19
132 0.13
133 0.1
134 0.08
135 0.11
136 0.12
137 0.13
138 0.13
139 0.15
140 0.15
141 0.17
142 0.19
143 0.18
144 0.19
145 0.22
146 0.28
147 0.28
148 0.29
149 0.33
150 0.32
151 0.29
152 0.28
153 0.24
154 0.18
155 0.16
156 0.15
157 0.1
158 0.09
159 0.09
160 0.09
161 0.07
162 0.08
163 0.08
164 0.08
165 0.1
166 0.11
167 0.1
168 0.13
169 0.13
170 0.13
171 0.14
172 0.15
173 0.13
174 0.14
175 0.15
176 0.14
177 0.14
178 0.14
179 0.14
180 0.18
181 0.24
182 0.32
183 0.36
184 0.4
185 0.48
186 0.58
187 0.66
188 0.71
189 0.74
190 0.75
191 0.8
192 0.81
193 0.81
194 0.79
195 0.8
196 0.78