Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409X8B2

Protein Details
Accession A0A409X8B2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MARNKTPRVQHDSPKKNRFIHydrophilic
54-78GSTKNRPRSGRPKKATDRVKRSIVRBasic
NLS Segment(s)
PositionSequence
57-88KNRPRSGRPKKATDRVKRSIVRNAVKERRKPF
Subcellular Location(s) mito 16, nucl 8, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MARNKTPRVQHDSPKKNRFIGLVLGGQNVHNASIMADIPSSTAADLWTKYKTTGSTKNRPRSGRPKKATDRVKRSIVRNAVKERRKPFRELANEGPGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.72
4 0.67
5 0.59
6 0.5
7 0.44
8 0.37
9 0.33
10 0.29
11 0.26
12 0.24
13 0.22
14 0.2
15 0.15
16 0.12
17 0.07
18 0.06
19 0.06
20 0.06
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.06
27 0.06
28 0.04
29 0.04
30 0.05
31 0.06
32 0.07
33 0.08
34 0.09
35 0.09
36 0.1
37 0.11
38 0.13
39 0.18
40 0.27
41 0.33
42 0.42
43 0.52
44 0.6
45 0.66
46 0.67
47 0.7
48 0.72
49 0.75
50 0.76
51 0.73
52 0.74
53 0.76
54 0.83
55 0.85
56 0.84
57 0.82
58 0.78
59 0.8
60 0.76
61 0.72
62 0.71
63 0.7
64 0.67
65 0.65
66 0.69
67 0.7
68 0.72
69 0.76
70 0.76
71 0.77
72 0.74
73 0.73
74 0.7
75 0.7
76 0.71
77 0.7
78 0.69