Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JVW4

Protein Details
Accession G8JVW4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-25KIVKKHTKKFKRHHSDR
Subcellular Location(s) mito 15.5, mito_nucl 14, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG erc:Ecym_7129  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRRRFRGNISEPTIGYGSSKKTKFMSPSGHKTYLVSNIKDLEVLMMHTKSYAAEIAHNVSSKNRVGILTRAKALGIKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.86
14 0.76
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.61
24 0.57
25 0.53
26 0.5
27 0.49
28 0.56
29 0.64
30 0.67
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.22
45 0.16
46 0.14
47 0.19
48 0.19
49 0.19
50 0.21
51 0.24
52 0.26
53 0.3
54 0.36
55 0.36
56 0.44
57 0.49
58 0.49
59 0.46
60 0.43
61 0.4
62 0.4
63 0.37
64 0.3
65 0.24
66 0.24
67 0.24
68 0.23
69 0.21
70 0.12
71 0.08
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.07
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.15
88 0.15
89 0.19
90 0.18
91 0.18
92 0.17
93 0.16
94 0.18
95 0.25
96 0.32
97 0.33
98 0.33
99 0.32
100 0.31
101 0.31
102 0.3
103 0.29
104 0.23
105 0.25
106 0.32
107 0.4
108 0.45
109 0.45
110 0.47
111 0.43