Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L8A3

Protein Details
Accession E2L8A3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
4-30SPLFWGLKTKAKRRRMKRGEDVKLGQGHydrophilic
NLS Segment(s)
PositionSequence
11-21KTKAKRRRMKR
Subcellular Location(s) mito 19, mito_nucl 12.666, cyto_mito 10.666, nucl 5, cyto_nucl 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR002501  PsdUridine_synth_N  
IPR014780  tRNA_psdUridine_synth_TruB  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0008033  P:tRNA processing  
KEGG mpr:MPER_02159  -  
Pfam View protein in Pfam  
PF01509  TruB_N  
Amino Acid Sequences MSLSPLFWGLKTKAKRRRMKRGEDVKLGQGGTLDPLADGVLVLGVGKGTKQLTQFLDCTKEYRTTCLLGCETDSYDSEGAKVRTAPWKHVTKEDVEKALSQFTGEIKQTPPIFSALKMDGKPLYEYARKGIPLPRPIEPRSVTVHNLKLEEWLGGSHSFKWPEKSLSEEEKKAVEKAIQGVDESATIKDEPETQREGTSDVPTAFVLSMKVSGGTYVRSVVHDLAHAVDSYWKSLGKKRSSVLSWDVFEKHSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.73
3 0.77
4 0.86
5 0.87
6 0.89
7 0.9
8 0.91
9 0.9
10 0.89
11 0.82
12 0.75
13 0.69
14 0.58
15 0.47
16 0.37
17 0.28
18 0.2
19 0.17
20 0.12
21 0.07
22 0.08
23 0.07
24 0.06
25 0.06
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.06
35 0.07
36 0.1
37 0.11
38 0.17
39 0.2
40 0.24
41 0.26
42 0.26
43 0.3
44 0.28
45 0.29
46 0.26
47 0.3
48 0.27
49 0.29
50 0.29
51 0.27
52 0.27
53 0.29
54 0.28
55 0.21
56 0.22
57 0.19
58 0.17
59 0.17
60 0.16
61 0.15
62 0.14
63 0.13
64 0.13
65 0.16
66 0.15
67 0.14
68 0.14
69 0.14
70 0.22
71 0.24
72 0.28
73 0.32
74 0.38
75 0.39
76 0.44
77 0.43
78 0.4
79 0.46
80 0.44
81 0.39
82 0.32
83 0.32
84 0.27
85 0.27
86 0.22
87 0.14
88 0.11
89 0.1
90 0.12
91 0.11
92 0.12
93 0.11
94 0.16
95 0.17
96 0.17
97 0.16
98 0.16
99 0.16
100 0.15
101 0.17
102 0.15
103 0.18
104 0.17
105 0.18
106 0.16
107 0.16
108 0.17
109 0.15
110 0.17
111 0.16
112 0.16
113 0.17
114 0.18
115 0.17
116 0.18
117 0.23
118 0.24
119 0.27
120 0.3
121 0.33
122 0.36
123 0.37
124 0.41
125 0.37
126 0.34
127 0.33
128 0.33
129 0.31
130 0.29
131 0.32
132 0.28
133 0.27
134 0.24
135 0.22
136 0.19
137 0.17
138 0.13
139 0.09
140 0.08
141 0.09
142 0.09
143 0.09
144 0.12
145 0.15
146 0.16
147 0.2
148 0.21
149 0.23
150 0.23
151 0.27
152 0.29
153 0.35
154 0.39
155 0.37
156 0.36
157 0.36
158 0.36
159 0.31
160 0.27
161 0.2
162 0.17
163 0.19
164 0.2
165 0.17
166 0.16
167 0.16
168 0.15
169 0.14
170 0.13
171 0.1
172 0.09
173 0.08
174 0.08
175 0.09
176 0.14
177 0.16
178 0.19
179 0.22
180 0.22
181 0.23
182 0.23
183 0.25
184 0.21
185 0.21
186 0.2
187 0.16
188 0.17
189 0.15
190 0.16
191 0.14
192 0.12
193 0.1
194 0.08
195 0.09
196 0.08
197 0.08
198 0.07
199 0.09
200 0.09
201 0.1
202 0.1
203 0.12
204 0.12
205 0.13
206 0.15
207 0.15
208 0.15
209 0.15
210 0.15
211 0.14
212 0.14
213 0.13
214 0.11
215 0.15
216 0.15
217 0.16
218 0.17
219 0.18
220 0.2
221 0.28
222 0.37
223 0.4
224 0.45
225 0.47
226 0.54
227 0.54
228 0.57
229 0.57
230 0.54
231 0.48
232 0.46
233 0.45
234 0.38