Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VYE6

Protein Details
Accession A0A409VYE6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-87PTPTPVRRRRQQWPIPQWFRLKTDTKIQYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MRDQAMLTDFENPAAQRHPLNLDSTTIQLAPRREPYFQAGHKQPPTPTPVRRRRQQWPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.15
4 0.18
5 0.21
6 0.21
7 0.23
8 0.22
9 0.21
10 0.21
11 0.21
12 0.19
13 0.15
14 0.15
15 0.16
16 0.17
17 0.18
18 0.24
19 0.25
20 0.24
21 0.26
22 0.29
23 0.32
24 0.33
25 0.36
26 0.33
27 0.38
28 0.4
29 0.4
30 0.36
31 0.32
32 0.36
33 0.35
34 0.38
35 0.42
36 0.5
37 0.56
38 0.63
39 0.67
40 0.7
41 0.75
42 0.76
43 0.77
44 0.77
45 0.8
46 0.79
47 0.78
48 0.75
49 0.68
50 0.62
51 0.57
52 0.51
53 0.44
54 0.48
55 0.51
56 0.49
57 0.54
58 0.58
59 0.62
60 0.68
61 0.73
62 0.74
63 0.76
64 0.79
65 0.82
66 0.85
67 0.85