Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409X1F3

Protein Details
Accession A0A409X1F3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
103-137LTRAEKRKLQEKLRSKENKRRKKEKMDEYLPRDSGBasic
NLS Segment(s)
PositionSequence
107-127EKRKLQEKLRSKENKRRKKEK
Subcellular Location(s) nucl 10, cyto_mito 7, mito 6.5, cyto 6.5, pero 3
Family & Domain DBs
Amino Acid Sequences MAATHLIPPVKNHRVTVLEPANSAFEFANGILAGYNQLVYGPHLSPAPSRSPSPSLPDSASPLQCDGGHSSSAGEPGPHDQRSSTSTLQERAPPAVLPVAETLTRAEKRKLQEKLRSKENKRRKKEKMDEYLPRDSGHAKKHLAGASHIPTSFEAEKMPISKAGFIALRSPDSAMTYRLEDFIGPNAKFNLKLVNWKGEETMVTTDKSERITTVCVSKPEGDETWEDMQQRAAQAIESARAKLHFSKKDRDHRRGGFPALAVGISHGGGQPYPKMRRQDPRNREALQELMSEPAFERISGHATGAFAQWAPRLCAYENRYLTELIEHDRQLRRENKHPKPSEEELRRVWPRTPWAATTFNFGPQTVCFKHIDYNNLAFGWCAITALGTFDHTKGGHLILWDLGIIIEFPAGCTILIPSAAIHHSNVIVGAHERRYSVTQYSAGGIFRWVDNNFQSVVNFREQMTPDERAAALERLSEQLDFGLSLYSDIAELEKKHDVSFKYAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.51
4 0.48
5 0.41
6 0.39
7 0.39
8 0.36
9 0.31
10 0.31
11 0.2
12 0.13
13 0.12
14 0.12
15 0.13
16 0.1
17 0.1
18 0.08
19 0.09
20 0.1
21 0.08
22 0.08
23 0.06
24 0.07
25 0.07
26 0.09
27 0.13
28 0.12
29 0.13
30 0.14
31 0.16
32 0.18
33 0.22
34 0.27
35 0.26
36 0.28
37 0.32
38 0.36
39 0.38
40 0.43
41 0.42
42 0.39
43 0.39
44 0.38
45 0.39
46 0.4
47 0.39
48 0.34
49 0.31
50 0.29
51 0.27
52 0.27
53 0.25
54 0.21
55 0.19
56 0.18
57 0.18
58 0.17
59 0.19
60 0.17
61 0.12
62 0.11
63 0.17
64 0.23
65 0.22
66 0.22
67 0.21
68 0.24
69 0.28
70 0.32
71 0.28
72 0.28
73 0.32
74 0.34
75 0.36
76 0.39
77 0.37
78 0.33
79 0.32
80 0.26
81 0.23
82 0.23
83 0.2
84 0.16
85 0.15
86 0.14
87 0.13
88 0.14
89 0.14
90 0.18
91 0.22
92 0.24
93 0.27
94 0.31
95 0.38
96 0.46
97 0.54
98 0.56
99 0.62
100 0.69
101 0.73
102 0.78
103 0.81
104 0.81
105 0.83
106 0.85
107 0.85
108 0.86
109 0.89
110 0.89
111 0.9
112 0.91
113 0.91
114 0.91
115 0.9
116 0.89
117 0.85
118 0.82
119 0.71
120 0.61
121 0.52
122 0.46
123 0.42
124 0.38
125 0.37
126 0.32
127 0.33
128 0.38
129 0.39
130 0.36
131 0.32
132 0.32
133 0.29
134 0.31
135 0.28
136 0.24
137 0.21
138 0.25
139 0.23
140 0.18
141 0.15
142 0.13
143 0.15
144 0.16
145 0.16
146 0.14
147 0.14
148 0.15
149 0.14
150 0.16
151 0.15
152 0.14
153 0.18
154 0.16
155 0.16
156 0.16
157 0.16
158 0.14
159 0.15
160 0.16
161 0.13
162 0.13
163 0.14
164 0.14
165 0.14
166 0.14
167 0.11
168 0.11
169 0.15
170 0.19
171 0.18
172 0.18
173 0.19
174 0.2
175 0.2
176 0.19
177 0.21
178 0.16
179 0.24
180 0.25
181 0.31
182 0.31
183 0.31
184 0.32
185 0.25
186 0.25
187 0.19
188 0.2
189 0.14
190 0.13
191 0.13
192 0.14
193 0.15
194 0.16
195 0.14
196 0.12
197 0.11
198 0.13
199 0.14
200 0.17
201 0.18
202 0.18
203 0.2
204 0.21
205 0.2
206 0.21
207 0.2
208 0.17
209 0.16
210 0.19
211 0.19
212 0.19
213 0.18
214 0.16
215 0.16
216 0.16
217 0.14
218 0.11
219 0.09
220 0.07
221 0.07
222 0.08
223 0.1
224 0.1
225 0.1
226 0.1
227 0.1
228 0.12
229 0.17
230 0.24
231 0.29
232 0.32
233 0.41
234 0.5
235 0.6
236 0.67
237 0.68
238 0.69
239 0.66
240 0.69
241 0.63
242 0.57
243 0.47
244 0.38
245 0.32
246 0.24
247 0.19
248 0.11
249 0.08
250 0.06
251 0.05
252 0.05
253 0.05
254 0.04
255 0.05
256 0.05
257 0.08
258 0.14
259 0.17
260 0.22
261 0.26
262 0.32
263 0.42
264 0.51
265 0.6
266 0.62
267 0.65
268 0.68
269 0.65
270 0.61
271 0.53
272 0.44
273 0.35
274 0.28
275 0.21
276 0.16
277 0.14
278 0.13
279 0.11
280 0.12
281 0.1
282 0.09
283 0.09
284 0.09
285 0.12
286 0.12
287 0.12
288 0.1
289 0.1
290 0.11
291 0.1
292 0.09
293 0.06
294 0.07
295 0.09
296 0.09
297 0.1
298 0.1
299 0.12
300 0.12
301 0.19
302 0.23
303 0.3
304 0.3
305 0.31
306 0.31
307 0.3
308 0.29
309 0.24
310 0.21
311 0.16
312 0.17
313 0.16
314 0.21
315 0.24
316 0.26
317 0.32
318 0.38
319 0.4
320 0.47
321 0.57
322 0.62
323 0.69
324 0.72
325 0.69
326 0.69
327 0.71
328 0.71
329 0.67
330 0.62
331 0.55
332 0.59
333 0.58
334 0.52
335 0.48
336 0.42
337 0.41
338 0.42
339 0.41
340 0.35
341 0.36
342 0.39
343 0.37
344 0.39
345 0.34
346 0.32
347 0.3
348 0.27
349 0.24
350 0.2
351 0.26
352 0.21
353 0.23
354 0.2
355 0.21
356 0.26
357 0.28
358 0.32
359 0.3
360 0.31
361 0.3
362 0.29
363 0.27
364 0.21
365 0.18
366 0.15
367 0.1
368 0.07
369 0.05
370 0.05
371 0.05
372 0.07
373 0.07
374 0.07
375 0.09
376 0.09
377 0.12
378 0.12
379 0.13
380 0.13
381 0.13
382 0.13
383 0.12
384 0.13
385 0.1
386 0.1
387 0.09
388 0.08
389 0.06
390 0.05
391 0.05
392 0.04
393 0.04
394 0.04
395 0.04
396 0.05
397 0.05
398 0.05
399 0.05
400 0.06
401 0.06
402 0.07
403 0.07
404 0.06
405 0.08
406 0.1
407 0.11
408 0.11
409 0.11
410 0.12
411 0.12
412 0.12
413 0.1
414 0.09
415 0.11
416 0.14
417 0.16
418 0.17
419 0.18
420 0.2
421 0.23
422 0.25
423 0.25
424 0.25
425 0.24
426 0.24
427 0.26
428 0.25
429 0.23
430 0.19
431 0.18
432 0.15
433 0.14
434 0.17
435 0.16
436 0.18
437 0.19
438 0.21
439 0.21
440 0.21
441 0.21
442 0.19
443 0.22
444 0.22
445 0.22
446 0.21
447 0.27
448 0.28
449 0.32
450 0.34
451 0.35
452 0.31
453 0.32
454 0.31
455 0.26
456 0.28
457 0.24
458 0.2
459 0.18
460 0.18
461 0.18
462 0.19
463 0.17
464 0.14
465 0.12
466 0.12
467 0.11
468 0.1
469 0.09
470 0.08
471 0.08
472 0.08
473 0.08
474 0.07
475 0.07
476 0.09
477 0.11
478 0.12
479 0.16
480 0.22
481 0.22
482 0.24
483 0.3
484 0.31
485 0.34