Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VXF2

Protein Details
Accession A0A409VXF2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-107QDVIDRKKRGKGPPKKAKTKADSRRLSKRRBasic
NLS Segment(s)
PositionSequence
83-107RKKRGKGPPKKAKTKADSRRLSKRR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAAFVPPSRLLALKKLQCSIFQTSFNPQSLRTGAKYLRARLRGPSMVAYYPDHFNVPQIIRKFPELEMVNEDEQERLQDVIDRKKRGKGPPKKAKTKADSRRLSKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.41
4 0.41
5 0.44
6 0.45
7 0.39
8 0.36
9 0.35
10 0.38
11 0.41
12 0.41
13 0.37
14 0.29
15 0.29
16 0.29
17 0.29
18 0.24
19 0.25
20 0.23
21 0.31
22 0.35
23 0.37
24 0.42
25 0.43
26 0.42
27 0.41
28 0.46
29 0.39
30 0.35
31 0.32
32 0.26
33 0.23
34 0.24
35 0.22
36 0.18
37 0.17
38 0.16
39 0.14
40 0.12
41 0.12
42 0.14
43 0.13
44 0.16
45 0.17
46 0.18
47 0.19
48 0.21
49 0.22
50 0.18
51 0.24
52 0.21
53 0.21
54 0.22
55 0.24
56 0.23
57 0.22
58 0.22
59 0.15
60 0.13
61 0.12
62 0.1
63 0.07
64 0.07
65 0.11
66 0.16
67 0.26
68 0.33
69 0.39
70 0.4
71 0.48
72 0.55
73 0.61
74 0.67
75 0.68
76 0.72
77 0.77
78 0.86
79 0.89
80 0.91
81 0.91
82 0.89
83 0.89
84 0.88
85 0.88
86 0.87
87 0.85