Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409VQ37

Protein Details
Accession A0A409VQ37    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
228-255QEELEERQKQLQKKKRREEERLQSEHSDHydrophilic
NLS Segment(s)
PositionSequence
240-243KKKR
Subcellular Location(s) mito 16.5, mito_nucl 13.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MSTFLAFRTAAVALSRHPKPIPSAIFPLLVRGLQAPRKYPKNHQIEQQQPFVQLKDENGSLGPPQRPSEILESMDLSTHVLRLVTSEPPIVQIFTLMEDKMRQLSHKAGKKAEKQKQSRGHILTKEIQLSWFTSGQDLEHRLSKIREELEKGNVRVDVILNPKAKVRNPTGLEMDEQLDEIARRVEDVGMEWRERDRRRGSATIFFQSTVKREPIQRLTEEEIRKRAQEELEERQKQLQKKKRREEERLQSEHSDSTSSTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.26
4 0.27
5 0.28
6 0.31
7 0.39
8 0.41
9 0.39
10 0.43
11 0.41
12 0.44
13 0.42
14 0.4
15 0.32
16 0.27
17 0.22
18 0.19
19 0.23
20 0.25
21 0.28
22 0.32
23 0.38
24 0.47
25 0.52
26 0.58
27 0.62
28 0.66
29 0.67
30 0.69
31 0.71
32 0.72
33 0.72
34 0.69
35 0.61
36 0.55
37 0.52
38 0.44
39 0.36
40 0.27
41 0.24
42 0.21
43 0.19
44 0.17
45 0.15
46 0.15
47 0.15
48 0.19
49 0.2
50 0.19
51 0.2
52 0.21
53 0.22
54 0.24
55 0.27
56 0.24
57 0.23
58 0.21
59 0.21
60 0.2
61 0.19
62 0.16
63 0.12
64 0.09
65 0.09
66 0.08
67 0.06
68 0.06
69 0.07
70 0.09
71 0.1
72 0.1
73 0.11
74 0.1
75 0.13
76 0.13
77 0.12
78 0.1
79 0.09
80 0.08
81 0.09
82 0.1
83 0.08
84 0.08
85 0.09
86 0.09
87 0.11
88 0.12
89 0.1
90 0.12
91 0.19
92 0.27
93 0.32
94 0.36
95 0.39
96 0.46
97 0.54
98 0.63
99 0.64
100 0.65
101 0.65
102 0.71
103 0.74
104 0.72
105 0.71
106 0.65
107 0.63
108 0.55
109 0.53
110 0.48
111 0.4
112 0.36
113 0.28
114 0.24
115 0.19
116 0.17
117 0.15
118 0.12
119 0.11
120 0.1
121 0.1
122 0.1
123 0.11
124 0.13
125 0.12
126 0.14
127 0.14
128 0.15
129 0.16
130 0.17
131 0.18
132 0.18
133 0.19
134 0.2
135 0.22
136 0.28
137 0.33
138 0.32
139 0.3
140 0.27
141 0.25
142 0.22
143 0.2
144 0.16
145 0.15
146 0.21
147 0.2
148 0.21
149 0.24
150 0.26
151 0.28
152 0.3
153 0.31
154 0.33
155 0.35
156 0.38
157 0.38
158 0.36
159 0.34
160 0.3
161 0.26
162 0.18
163 0.15
164 0.11
165 0.09
166 0.08
167 0.07
168 0.07
169 0.06
170 0.06
171 0.07
172 0.07
173 0.07
174 0.08
175 0.14
176 0.16
177 0.16
178 0.17
179 0.2
180 0.28
181 0.3
182 0.36
183 0.36
184 0.4
185 0.46
186 0.51
187 0.52
188 0.53
189 0.55
190 0.52
191 0.48
192 0.42
193 0.37
194 0.33
195 0.32
196 0.28
197 0.27
198 0.25
199 0.28
200 0.36
201 0.42
202 0.45
203 0.44
204 0.45
205 0.48
206 0.53
207 0.55
208 0.52
209 0.51
210 0.48
211 0.47
212 0.43
213 0.41
214 0.37
215 0.38
216 0.39
217 0.43
218 0.51
219 0.53
220 0.53
221 0.57
222 0.59
223 0.59
224 0.63
225 0.63
226 0.64
227 0.71
228 0.81
229 0.84
230 0.88
231 0.91
232 0.91
233 0.92
234 0.92
235 0.87
236 0.81
237 0.74
238 0.66
239 0.58
240 0.48
241 0.39