Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XCI8

Protein Details
Accession A0A409XCI8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-46KVELKPLKLTKKEAKKVRKLRRKAELEDKRDRVRBasic
NLS Segment(s)
PositionSequence
16-43LKPLKLTKKEAKKVRKLRRKAELEDKRD
Subcellular Location(s) nucl 14, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR013881  Pre-mRNA_splic_Prp3_dom  
IPR027104  Prp3  
IPR010541  Prp3_C  
Gene Ontology GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF06544  DUF1115  
PF08572  PRP3  
Amino Acid Sequences HPIPIPAPGDKDKVELKPLKLTKKEAKKVRKLRRKAELEDKRDRVRMGLLPPDPPKVRLANLMKVLTSDAIQDPTRVEARVRREVAMRKHQHEKMNAERKLTDEQRREKLEAKKEMEERKGLVGAVFRVNILTDPSHQFKVRKNADQLSLSGVCIFNPAFSLVYVEGAAKYIKQYKRLMLHRIAWTEAARPRGGAAGAAGEEVELEDPESDVEGEGGEGAGASSKAGKARAGSKTPAPGAESDQEASTQKSLENNRCVLIWEGALRQREFAGFKARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.43
4 0.48
5 0.55
6 0.6
7 0.6
8 0.65
9 0.66
10 0.71
11 0.77
12 0.77
13 0.81
14 0.83
15 0.88
16 0.91
17 0.91
18 0.9
19 0.9
20 0.91
21 0.88
22 0.85
23 0.86
24 0.85
25 0.83
26 0.83
27 0.8
28 0.75
29 0.7
30 0.62
31 0.53
32 0.47
33 0.43
34 0.38
35 0.39
36 0.35
37 0.38
38 0.4
39 0.45
40 0.42
41 0.38
42 0.37
43 0.32
44 0.32
45 0.35
46 0.37
47 0.37
48 0.42
49 0.41
50 0.37
51 0.34
52 0.34
53 0.25
54 0.2
55 0.15
56 0.1
57 0.13
58 0.13
59 0.13
60 0.13
61 0.16
62 0.17
63 0.15
64 0.16
65 0.18
66 0.25
67 0.33
68 0.34
69 0.33
70 0.37
71 0.44
72 0.5
73 0.56
74 0.55
75 0.52
76 0.59
77 0.63
78 0.63
79 0.62
80 0.61
81 0.61
82 0.64
83 0.61
84 0.54
85 0.49
86 0.46
87 0.47
88 0.47
89 0.45
90 0.43
91 0.48
92 0.53
93 0.56
94 0.56
95 0.56
96 0.56
97 0.57
98 0.57
99 0.54
100 0.53
101 0.55
102 0.59
103 0.54
104 0.48
105 0.4
106 0.33
107 0.3
108 0.24
109 0.18
110 0.13
111 0.12
112 0.11
113 0.1
114 0.09
115 0.08
116 0.08
117 0.08
118 0.08
119 0.07
120 0.08
121 0.11
122 0.14
123 0.16
124 0.17
125 0.2
126 0.23
127 0.33
128 0.36
129 0.38
130 0.4
131 0.41
132 0.43
133 0.42
134 0.37
135 0.31
136 0.27
137 0.21
138 0.18
139 0.15
140 0.11
141 0.11
142 0.1
143 0.06
144 0.06
145 0.07
146 0.06
147 0.06
148 0.08
149 0.06
150 0.07
151 0.07
152 0.07
153 0.06
154 0.07
155 0.07
156 0.05
157 0.07
158 0.15
159 0.17
160 0.23
161 0.25
162 0.3
163 0.39
164 0.45
165 0.49
166 0.46
167 0.51
168 0.5
169 0.49
170 0.44
171 0.37
172 0.32
173 0.31
174 0.29
175 0.26
176 0.21
177 0.19
178 0.18
179 0.18
180 0.17
181 0.12
182 0.09
183 0.07
184 0.07
185 0.07
186 0.06
187 0.05
188 0.04
189 0.04
190 0.05
191 0.03
192 0.04
193 0.04
194 0.04
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.04
210 0.05
211 0.06
212 0.09
213 0.1
214 0.12
215 0.14
216 0.22
217 0.29
218 0.32
219 0.35
220 0.37
221 0.42
222 0.42
223 0.41
224 0.35
225 0.3
226 0.3
227 0.29
228 0.27
229 0.22
230 0.21
231 0.21
232 0.21
233 0.21
234 0.18
235 0.16
236 0.15
237 0.21
238 0.29
239 0.36
240 0.41
241 0.41
242 0.41
243 0.4
244 0.41
245 0.37
246 0.31
247 0.24
248 0.21
249 0.23
250 0.28
251 0.33
252 0.31
253 0.29
254 0.28
255 0.29
256 0.29
257 0.28