Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YLH3

Protein Details
Accession A0A409YLH3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MDLLQIWDRHRRRRPGLKSPSKSPRHLKIPSKYHASKPKRSSNVRRSSTHydrophilic
NLS Segment(s)
PositionSequence
9-42RHRRRRPGLKSPSKSPRHLKIPSKYHASKPKRSS
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDLLQIWDRHRRRRPGLKSPSKSPRHLKIPSKYHASKPKRSSNVRRSSTAAFCIVREILQSSSASATSCEGFNKRAADQAASSSDIGNDLGPKNDVGLRVFNSSKIREVEEQGTAAASNRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.88
4 0.89
5 0.86
6 0.86
7 0.87
8 0.83
9 0.81
10 0.78
11 0.76
12 0.74
13 0.76
14 0.75
15 0.74
16 0.76
17 0.74
18 0.74
19 0.69
20 0.69
21 0.7
22 0.69
23 0.69
24 0.68
25 0.73
26 0.72
27 0.78
28 0.8
29 0.8
30 0.83
31 0.77
32 0.72
33 0.66
34 0.61
35 0.54
36 0.45
37 0.38
38 0.27
39 0.23
40 0.22
41 0.18
42 0.14
43 0.12
44 0.11
45 0.08
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.06
55 0.07
56 0.08
57 0.09
58 0.1
59 0.13
60 0.15
61 0.14
62 0.18
63 0.18
64 0.18
65 0.17
66 0.18
67 0.17
68 0.17
69 0.17
70 0.13
71 0.12
72 0.11
73 0.11
74 0.09
75 0.09
76 0.08
77 0.09
78 0.1
79 0.1
80 0.11
81 0.12
82 0.14
83 0.13
84 0.16
85 0.18
86 0.22
87 0.23
88 0.26
89 0.29
90 0.29
91 0.33
92 0.31
93 0.33
94 0.31
95 0.36
96 0.35
97 0.32
98 0.31
99 0.26
100 0.24
101 0.2